SecReT6
Protein ID: 300715168
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05800
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]679888..683508 [+]
Producttype VI secretion system, IcmF
NoteTssM
UniProt IDD8MMQ4
KEGG IDebi:EbC_05800
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-102, Aligned region: 205..483
IcmF-related [PF06761], Evalue: 8.90E-83, Aligned region: 531..833
DUF1215 [PF06744], Evalue: 4.90E-31, Aligned region: 947..1072
Protein Sequence: 1206 a.a.     [Download]
>gi|300715168|ref|YP_003739971.1| unnamed protein product [Erwinia billingiae Eb661]
MLNILFSIMTSRLMWGFIGITALSFIIWVIGPVFSIADSRPLEPEVNRQISIGLLYVAWGLSNLVPRLYN
AWLNRKLMGSLKTTPGEEGSADNKRLTSEDRVLSERFTEAAEMLKKAHFSGAGNKRWTQRFSRQYLYQLP
WYVIIGAPGAGKTTALVNSGLKFPLADRFGKAALRGIGGTRNCDWWFTNQAVLLDTAGRYTTQESEQQQD
ASEWGNFVGLLRKYRGRQPINGVIVTISVSDLLTQSAEASRQQALSLRQRLMELHEQLGIRFPVYVMVTK
TDLLKGFRSYFARFDKAQRDQVWGFTFPWERSKLADFDLLSAFTQEYALLQQRLDAGLPDTLLQESDGKA
RAESYLFPQEFAALRPLLNDYLETVFSRSNFETQFSPRGIYFASGTQEGLPFDRVMGELNRALNLPQEEG
GNSKAWDQVDKAAPIPANKGQSYFLKDLLQNVIFQEAGLAGSNRWWELRNRAVLWSGYLLLAAALIVAGV
LWITSYNNNKAYLQEVQAKVPQVVKLSQNLQANDLTDLYALLPFLNGVLHLPESEDFDLNDPPITRRMGL
YRGVEVSDATLSLYQKSLKQLLMPQVAQLITTWLRNDNGSDADYSYEALKAYQMLYQPKHYDGKFLHAWL
MLNIQRNQPQNITQQQIKQLDWHLMQLLETQIQASPYARDDALVKREQALINQMPLSQRVYGRLKRLLER
DDALKSVSLASLGGPQSELVFSRKSGKSIGEGIPGLFTPDGYWNSFDKNIDSVTAALHDDDQWVLGGQVQ
GETKEQTDLAVRQLYMADYMRQWDGLLQDIQLNNSADLSQRINAARLLSSSNSPLRKLVINLSHYLVLEK
AAPEEDTAKAGEDKQESSASSTLSALFRSRQASTAASQQQQTPEQSVTAHFAPVIELAQPLEKGGKTIAF
DDFLKQIDDLYRYLTAVQDAANSGMPPPASDSISRLQASAGRLPGSLQNMFTSMAVGASSDTQRRDLDNV
RKRINVEVGSFCRQAIAGRYPLSRSGRSEVTPDDLARMFAPGTGLMDSFFRDNLANKVDTTQSSWRFTPG
IDGKTLPGGESVLRPFQQAQSIRDAFFANGATTPSFRVTVRTVQMDNNILTLTLDVDGQLLRYSHGPQAV
QLMNWPGPGGTNQVRMQLGLADGTTATLVTNGAWALNRFFDRAELSRGSSSLSRQAAFNVNGHRVTLEFT
PNSIRNPFQLPGFSCP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|300714588|ref|NC_014306.1|:679888-683508 Erwinia billingiae Eb661 chromosome, complete genome
ATGCTGAATATTCTATTTTCCATCATGACCAGCCGTCTGATGTGGGGTTTTATCGGCATCACCGCGCTCT
CCTTTATCATCTGGGTGATTGGGCCGGTGTTCTCGATTGCGGATTCTCGCCCACTGGAGCCGGAAGTGAA
CCGCCAGATCAGTATCGGGCTGCTGTACGTGGCGTGGGGACTGAGCAATCTGGTGCCGCGCCTGTATAAC
GCCTGGCTGAACCGCAAACTGATGGGCAGCCTGAAAACCACGCCGGGCGAAGAGGGCAGCGCTGACAACA
AGCGTCTGACCAGTGAAGACCGCGTGCTGTCCGAGCGCTTTACCGAAGCCGCCGAGATGCTGAAAAAGGC
CCACTTCAGCGGCGCGGGCAATAAGCGCTGGACCCAGCGCTTCAGCCGTCAGTATCTGTATCAACTGCCG
TGGTACGTGATTATCGGCGCACCGGGCGCGGGCAAAACCACCGCGCTGGTCAACTCCGGGCTGAAGTTCC
CGCTGGCCGACCGCTTTGGTAAAGCGGCGCTGCGCGGCATTGGCGGCACCCGCAACTGCGACTGGTGGTT
CACCAATCAGGCGGTGCTGCTGGATACCGCCGGACGCTACACCACCCAGGAAAGCGAGCAGCAACAGGAT
GCCAGCGAGTGGGGTAACTTTGTTGGACTGCTGCGGAAATATCGCGGTCGCCAGCCGATCAACGGCGTGA
TTGTCACCATCAGCGTCTCCGATTTGCTAACGCAATCGGCTGAAGCGTCGCGTCAGCAGGCGCTTTCGCT
GCGACAGCGTCTGATGGAGCTGCATGAGCAGCTGGGTATCCGTTTCCCGGTTTACGTAATGGTCACCAAA
ACGGATTTGCTAAAAGGCTTCCGTTCGTACTTTGCCCGTTTTGATAAGGCGCAGCGCGATCAGGTCTGGG
GCTTCACCTTCCCGTGGGAACGCTCGAAGCTGGCCGATTTCGATCTGTTAAGCGCCTTTACCCAGGAATA
TGCTCTGCTGCAACAGCGGCTGGATGCCGGTCTGCCGGACACGCTGTTACAGGAAAGCGACGGCAAAGCC
CGGGCCGAAAGCTACCTGTTCCCGCAGGAGTTTGCGGCGCTGCGCCCGCTGCTGAATGACTATCTGGAAA
CCGTCTTCAGCCGCTCCAATTTTGAAACGCAGTTCTCGCCACGCGGCATCTACTTTGCCAGCGGCACTCA
GGAAGGTCTGCCGTTTGACCGGGTGATGGGCGAACTGAACCGCGCGCTGAATCTGCCGCAGGAAGAGGGC
GGCAACAGCAAAGCGTGGGATCAGGTGGATAAAGCCGCGCCGATCCCGGCCAACAAAGGGCAAAGCTACT
TCCTGAAAGACCTGCTGCAAAACGTCATTTTCCAGGAAGCCGGGCTGGCGGGCAGTAACCGCTGGTGGGA
GCTGCGCAATCGTGCCGTTCTGTGGTCCGGCTATCTGCTGCTGGCCGCAGCGCTGATCGTGGCCGGCGTG
CTGTGGATCACCAGTTACAACAATAACAAAGCCTATTTGCAGGAAGTGCAGGCGAAAGTGCCGCAGGTGG
TGAAGCTCAGCCAGAACCTGCAGGCCAACGATCTGACCGATCTGTATGCGCTGCTGCCGTTCCTCAATGG
CGTGCTGCATCTGCCGGAGAGTGAGGACTTCGATCTGAACGATCCGCCGATCACCCGCCGGATGGGGCTG
TATCGCGGTGTGGAAGTCAGTGATGCGACGTTGTCGCTGTACCAGAAATCCCTGAAGCAGCTGCTGATGC
CGCAGGTGGCTCAGCTAATCACCACCTGGCTGCGTAATGACAACGGCAGTGATGCGGATTACAGCTACGA
AGCGCTGAAAGCCTATCAGATGCTGTACCAGCCAAAGCATTACGACGGCAAATTCCTGCACGCCTGGCTG
ATGCTGAATATTCAGCGCAACCAGCCGCAGAACATCACCCAGCAACAGATCAAGCAGCTCGACTGGCATC
TGATGCAGCTGCTGGAGACGCAAATTCAGGCGTCGCCGTATGCGCGGGATGATGCTCTGGTAAAGCGCGA
GCAGGCGCTGATTAATCAGATGCCGCTGTCGCAGCGGGTCTATGGACGCCTCAAGCGCCTGCTGGAAAGG
GATGATGCACTGAAGTCGGTATCGCTGGCTTCACTCGGGGGGCCACAAAGCGAACTGGTCTTCTCACGTA
AAAGCGGCAAGTCGATTGGTGAAGGCATTCCGGGGCTGTTTACCCCAGACGGTTACTGGAACAGCTTCGA
CAAAAACATCGACAGCGTCACGGCGGCTTTGCATGACGATGACCAGTGGGTGCTGGGCGGACAGGTGCAG
GGCGAGACAAAGGAGCAAACCGATCTGGCCGTCCGCCAGCTCTATATGGCCGATTACATGCGTCAGTGGG
ATGGCTTACTGCAGGACATCCAGCTGAACAACAGCGCGGATTTATCGCAACGCATCAATGCGGCGCGTCT
GCTTTCCAGCAGCAATTCGCCGCTGCGCAAACTGGTGATTAACCTCAGCCACTATCTGGTGCTGGAGAAA
GCGGCCCCGGAAGAGGATACGGCGAAGGCCGGCGAGGACAAGCAGGAGAGCAGCGCCAGCAGCACGCTGA
GCGCGCTGTTCCGCTCACGCCAGGCCAGCACCGCCGCCAGCCAGCAGCAGCAAACGCCGGAGCAGTCAGT
AACCGCTCACTTCGCACCGGTGATTGAACTGGCTCAGCCACTGGAGAAAGGCGGCAAAACCATCGCCTTC
GATGATTTCCTTAAGCAAATCGACGACCTCTATCGCTACCTGACCGCGGTGCAGGATGCGGCCAACAGCG
GTATGCCGCCGCCAGCCAGCGATTCAATCAGTCGTCTGCAGGCCAGCGCCGGTCGCCTGCCGGGCTCACT
GCAAAACATGTTCACCAGCATGGCGGTGGGTGCCAGCAGTGATACCCAGCGTCGCGATCTGGATAACGTG
CGCAAGCGGATCAATGTCGAAGTGGGCAGCTTCTGCCGTCAGGCGATTGCCGGGCGCTATCCGCTCTCCC
GCAGTGGCCGTTCTGAAGTGACGCCTGACGATCTGGCGCGGATGTTTGCACCGGGCACCGGTTTGATGGA
CAGCTTCTTCCGCGACAATCTCGCCAACAAGGTCGATACCACGCAGTCGAGCTGGCGCTTTACGCCGGGC
ATCGACGGCAAGACCTTGCCAGGCGGCGAAAGTGTGCTGCGCCCATTCCAGCAAGCGCAAAGTATTCGTG
ATGCCTTCTTTGCCAATGGCGCGACCACGCCTTCATTCCGCGTCACTGTCCGCACCGTGCAGATGGATAA
CAACATCCTGACCTTAACGCTGGATGTGGATGGACAGCTGCTGCGTTACAGCCACGGGCCGCAGGCGGTC
CAGCTGATGAACTGGCCGGGCCCCGGCGGCACCAACCAGGTGCGTATGCAGCTGGGGCTGGCGGATGGCA
CCACCGCCACGCTGGTCACCAACGGCGCATGGGCACTGAATCGCTTCTTTGACCGCGCCGAACTCTCGCG
CGGCAGCAGCAGCCTCAGCCGCCAGGCGGCCTTTAACGTCAATGGTCATCGGGTGACGCTGGAGTTCACG
CCAAACAGTATCCGTAATCCGTTTCAGCTTCCCGGGTTCTCATGCCCCTAA
 Primer design