SecReT6
Protein ID: 300715170
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05820
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]684258..685274 [+]
Producthypothetical protein
NoteTssA
UniProt IDD8MMQ6
KEGG IDebi:EbC_05820
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-20, Aligned region: 52..111
DUF1403 [PF07183], Evalue: 0.0071, Aligned region: 127..214
Protein Sequence: 338 a.a.     [Download]
>gi|300715170|ref|YP_003739973.1| unnamed protein product [Erwinia billingiae Eb661]
MNIDALLEPISADKPCGENLEYDADYMAMEQACAGKAEQQFGSTIIPAEPADWNKVERLASDLLSRTKDL
RVMLALTRAWTQLKGLPGYANGLELIKQSLLRYWEPLWPVLEEDGERDPFYRVNALAALSDKSALTTAAR
QAPLIRSASDEISLRDACALLDGSKTECPEYPGGLARLTDELARAGQPGVEAILSISERLQTIRQTLVEH
LGETGVPEMEQLQKTVNTVAQACEVTDLASLIPGLTPASDEVPQPSPAARPARADMDWRTIQPGSRSDAQ
LMLEKVKQYFVQHEPSHPAPLMIDRVQRMIALDFMDIIRDLAPDGVHQLENIFGRRDN
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|300714588|ref|NC_014306.1|:684258-685274 Erwinia billingiae Eb661 chromosome, complete genome
ATGAATATCGATGCGCTACTTGAGCCGATAAGCGCTGACAAGCCCTGCGGCGAGAATCTGGAATACGACG
CCGATTACATGGCGATGGAGCAGGCCTGCGCGGGCAAAGCCGAGCAGCAATTTGGCAGCACCATCATTCC
TGCCGAGCCTGCGGACTGGAACAAAGTCGAGCGGCTGGCCAGCGACCTGCTGAGCCGCACCAAAGATCTC
CGCGTGATGCTGGCATTGACCCGCGCCTGGACGCAGCTGAAAGGGCTGCCGGGTTACGCCAACGGCCTGG
AGCTGATCAAGCAGTCTTTGCTGCGTTACTGGGAGCCGCTCTGGCCGGTGCTGGAGGAGGACGGTGAGCG
CGATCCGTTTTACCGCGTCAATGCGCTGGCGGCGTTAAGCGATAAGTCAGCACTCACTACCGCAGCCCGT
CAGGCCCCTTTAATTCGCAGCGCCTCAGATGAGATTTCGCTGCGCGATGCCTGCGCACTGCTGGACGGCA
GCAAAACCGAATGCCCGGAGTATCCCGGCGGTCTCGCACGGCTGACAGATGAACTGGCGCGTGCAGGTCA
ACCCGGCGTGGAAGCCATCCTGAGCATAAGTGAGCGGTTACAAACAATTCGTCAAACGCTGGTGGAACAC
CTTGGCGAAACCGGCGTGCCGGAGATGGAGCAGCTGCAAAAAACGGTGAACACCGTCGCGCAGGCCTGTG
AAGTCACCGATCTGGCGAGCCTGATCCCCGGCTTAACGCCAGCGAGTGATGAAGTCCCGCAGCCATCGCC
AGCCGCAAGACCGGCGCGTGCCGATATGGACTGGCGCACGATTCAGCCTGGCTCGCGTTCTGATGCCCAG
CTGATGCTGGAAAAAGTGAAGCAGTACTTTGTGCAGCACGAGCCAAGCCATCCGGCTCCGCTGATGATCG
ACCGCGTACAGCGGATGATCGCGCTCGACTTTATGGACATCATCCGTGATTTGGCGCCAGACGGCGTGCA
TCAGCTGGAAAATATCTTCGGACGCCGCGATAACTGA
 Primer design