SecReT6
Protein ID: 300715171
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05830
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]685322..685849 [+]
Producthypothetical protein
NoteTssB
UniProt IDD8MMQ7
KEGG IDebi:EbC_05830
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-59, Aligned region: 12..163
Protein Sequence: 175 a.a.     [Download]
>gi|300715171|ref|YP_003739974.1| unnamed protein product [Erwinia billingiae Eb661]
MATSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIELPFVMGVMSDLVGKSVEGLPAVDERKFLEIDIDN
FDERMKALKPRVAFQADNTLTGEGRLNIDLTFNSMEDFSPDAVARNVEPLNQLLDARTQLSNLLTYMDGK
NGAEELISKILQDPTLLKSLSHLPKQDEAAKSGEE
 
Nucleotide Sequence: 528 bp     [Download]
>gi|300714588|ref|NC_014306.1|:685322-685849 Erwinia billingiae Eb661 chromosome, complete genome
ATGGCAACAAGTAAATCCAGTGGGCAGAAATTTATCGCCCGTAACCGTGCGCCACGTGTGCAGATCGAAT
ACGACGTGGAGATCTATGGCGCGGAACGCAAAATTGAACTGCCGTTTGTGATGGGCGTGATGTCCGACCT
GGTCGGTAAATCGGTCGAAGGCCTGCCGGCCGTAGACGAGCGCAAGTTCCTTGAAATCGATATCGACAAC
TTCGACGAACGCATGAAGGCGCTGAAACCTCGCGTGGCGTTCCAGGCGGACAACACCTTGACCGGCGAAG
GGCGACTGAACATCGATCTGACCTTCAACAGCATGGAAGATTTCTCGCCGGATGCGGTGGCGCGTAACGT
TGAGCCGCTGAATCAGCTGCTGGATGCACGCACACAGCTTTCCAACCTGCTGACCTATATGGACGGCAAA
AACGGCGCGGAAGAGCTGATCTCCAAAATTCTGCAGGATCCTACGCTGCTGAAATCACTGAGCCACCTGC
CGAAGCAGGATGAAGCCGCTAAAAGTGGGGAGGAATAA
 Primer design