SecReT6
Protein ID: 300715172
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05840
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]685853..687352 [+]
Producthypothetical protein
NoteTssC
UniProt IDD8MMQ8
KEGG IDebi:EbC_05840
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|300715172|ref|YP_003739975.1| unnamed protein product [Erwinia billingiae Eb661]
MSNPSLQSELQEQQAYSQDEFSALLNKEFRPKTDSARAAVESAVKTLAQQALENTVTVSTDAYRTIQALI
AEIDEKLSQQVNQIIHHEDFQKLEGAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVGWDQS
PIFKKVYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGAASHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNSEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHSNYTWTN
AAYAMAANINRSFKEYGWCTSIRGVESGGSVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLASRLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLASAEVQVEEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|300714588|ref|NC_014306.1|:685853-687352 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGCAATCCTTCACTACAGTCCGAACTGCAGGAACAGCAGGCTTACAGTCAGGATGAGTTCAGCGCGC
TGCTGAATAAAGAGTTCCGTCCTAAGACCGACTCTGCGCGTGCCGCCGTGGAAAGCGCGGTGAAAACGCT
GGCGCAGCAGGCGCTGGAAAATACCGTCACCGTTTCCACCGATGCCTACCGCACGATTCAGGCGCTGATC
GCGGAGATCGACGAGAAGCTGTCTCAGCAGGTAAACCAGATCATCCACCACGAAGACTTCCAGAAGCTGG
AAGGGGCGTGGCGTGGCCTGAGCTACCTGGTGAACAACACCGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCCAAGCAGGAACTGGGCCGCACGCTGAAGCGTTATAAAGGCGTCGGCTGGGACCAGAGC
CCGATCTTCAAGAAGGTGTACGAAGAAGAGTATGGCCAGTTCGGTGGCGAGCCGTTCGGTTGCCTGGTCG
GCGATTACTACTTCGACCACAGCCCGCAGGACGTTGAGCTGCTGAGCGAAATGGCGCGCATTGGCGCGGC
TTCACACTGTCCGTTCATCACCGGGACTGCGCCGGGCGTGATGCAGATGGAATCCTGGCAGGAGCTGGCG
AACCCACGTGACCTGACCAAAATCTTCCAGAACAGCGAATATGCCGCCTGGCGCAGCCTGCGGGAATCGG
AAGATGCCCGTTATCTGGGCCTGGTGATGCCACGCTTCCTGTCGCGTCTGCCGTACGGCATTCGCACCAA
CCCGGTGGACAGCTTCGACTTCGAAGAGCAGACCGACGGTGCGAACCACAGCAATTACACCTGGACCAAC
GCTGCCTATGCGATGGCGGCTAACATCAACCGCTCCTTCAAAGAGTACGGCTGGTGCACCTCAATCCGTG
GCGTGGAGTCAGGCGGTTCGGTAGAAAACCTGCCTTGCCACACCTTCCCAAGCGATGACGGCGGCGTGGA
TATGAAGTGCCCGACCGAAATCGCCATCAGCGACCGTCGCGAAGCAGAGTTGGCGAAAAACGGCTTTATG
CCGCTGGTTCACCGCAAGAACTCCGACTTTGCCGCCTTTATCGGCGCACAGTCTTTGCAGAAGCCTGCGG
AATACCACGATGCCGATGCCACCGCGAATGCCCGTCTGGCATCGCGCCTGCCGTACCTGTTCGCCTGCTG
CCGCTTCGCGCATTACCTGAAGTGCATCGTGCGTGACAAGATCGGATCCTTCCGCGAGCGTGACGAGATG
GAACGCTGGCTGAACGACTGGGTGATGAACTACGTCGATGGGGATCCGGCTAACTCTTCGCAGGAAACCA
AATCCCGCAAGCCGCTGGCATCTGCAGAGGTGCAGGTTGAAGAGATCGAAGACAACCCCGGCTACTACGC
CGCCAAGTTCTTCCTGCGCCCGCACTACCAGCTGGAAGGCCTGACCGTGTCGCTGCGTCTGGTATCAAAA
CTGCCTTCTTTGAAATCTAACGATGCGTAA
 Primer design