SecReT6
Protein ID: 300715173
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05850
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]687947..688429 [+]
Producthypothetical protein
NoteTssD
UniProt IDD8MMQ9
KEGG IDebi:EbC_05850
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-37, Aligned region: 6..136
Peptidase_C14 [PF00656], Evalue: 0.0073, Aligned region: 52..155
Protein Sequence: 160 a.a.     [Download]
>gi|300715173|ref|YP_003739976.1| unnamed protein product [Erwinia billingiae Eb661]
MAIDMFMKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVEALIDKSVTALL
KNCASGKHLTKIELSICKAGGTQVEYARITLEDVLVTTVNYNGADNGDLVGMSYSFQSSKVKQQYWEQSS
SGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|300714588|ref|NC_014306.1|:687947-688429 Erwinia billingiae Eb661 chromosome, complete genome
ATGGCTATTGATATGTTTATGAAAGTTGACGGTGTGACTGGCGAATCAAAAGATTCAAACCACACCGGTT
GGACCGATATTACTTCTTTCTCCTGGGGCGCTTCACAGCCAGGCAATATGTCTGTGGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTCAATGATTTGCATGTTGAGGCATTGATCGATAAGTCAGTAACTGCTCTATTG
AAAAATTGCGCGAGTGGTAAACATCTTACTAAAATCGAACTTTCGATCTGTAAAGCGGGTGGTACTCAGG
TTGAGTATGCACGCATTACTCTCGAAGATGTCCTGGTAACCACAGTAAATTATAATGGTGCTGACAATGG
CGACTTAGTAGGAATGTCGTATTCATTCCAGTCCTCTAAAGTTAAACAACAGTATTGGGAGCAGAGCTCC
TCGGGTGGTAAAGGCGCAGAAAGTAGCGCAGGTTGGAATATTAAAGAAAATAAAGAAGCGTAA
 Primer design