SecReT6
Protein ID: 300715176
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05880
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]692294..694342 [+]
ProductForkhead-associated (FHA) protein
NoteFha
UniProt IDD8MMR2
KEGG IDebi:EbC_05880
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.70E-08, Aligned region: 27..94
Protein Sequence: 682 a.a.     [Download]
>gi|300715176|ref|YP_003739979.1| unnamed protein product [Erwinia billingiae Eb661]
MRFTIIATKSGQQPPQGSCDFMPPGGTIGRGTENNLVLPDENRSISRLQAIVHVSANGECQITNRGTVTL
VHLNDIPLQRGRQVELQDGDIIRIDDYALQVSELGAGAQPIVSAPIARAVVSDAPASAQASPQHVSSPSA
APNAASQPVPPNTAPQAAAAPSATAHAAQPPVSTQAASANTVIPQPQPSAPQPAAKENSPAAIPSEIWDS
LAQEFSISDSLSNRSKPQPANLNPFAEAPAPDRNPVDPLAQFASKPDSLNFDRRDQTPDSLFTDDDGLFK
QDSIFNDSTPSTLMQQPAAQPQQPGKGKDELDPLALFGGSGGGAPAQANSDDPLGLMMGNAVPLTPMDAS
GSQPRPATQQPPQHTIVPPAPHALDSDFDLFAGDKSNTQHASPLFDDAPQHGDETPSRSADSPADLADSP
LFDQPPTAAQPDYGGITLPTPQAVARNTTPPPKGRLRIDPVSNTASQQSSSSASSGQVLDGELLDALIGG
MGLNDLQPTPRIDRDSMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMTVILDEANNPFKLLPSGKSVL
MQMFGSRMPGFMPPKQSVRDALVDLQAHQLGMIAGIRAIIASMLQSFNPQQLEEEAKQEGITSRISLPSS
RKAALWEHFTKRYGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQIRSEE
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|300714588|ref|NC_014306.1|:692294-694342 Erwinia billingiae Eb661 chromosome, complete genome
ATGCGATTTACGATAATAGCGACCAAATCGGGTCAGCAACCGCCACAGGGTAGCTGCGACTTTATGCCGC
CGGGCGGTACCATTGGCCGGGGAACTGAAAATAATCTGGTGCTGCCGGATGAGAACCGCTCCATCTCCCG
CCTGCAGGCGATTGTGCATGTCAGCGCAAATGGCGAATGCCAAATTACCAACCGCGGCACCGTCACTCTG
GTACACCTGAATGATATTCCTCTGCAACGCGGCCGCCAGGTGGAACTGCAGGATGGCGATATCATCCGTA
TTGATGATTACGCACTGCAGGTGAGCGAGCTGGGTGCGGGCGCGCAACCCATAGTTAGCGCGCCGATTGC
CCGCGCCGTGGTAAGCGATGCGCCAGCGTCAGCGCAGGCCTCGCCACAGCACGTATCATCACCATCGGCG
GCTCCCAATGCCGCTTCGCAACCTGTACCGCCGAACACTGCACCGCAGGCAGCGGCTGCACCGTCTGCAA
CTGCACATGCCGCGCAGCCGCCGGTGTCCACGCAGGCCGCCTCAGCGAATACGGTAATTCCACAGCCGCA
GCCTTCAGCACCGCAGCCTGCTGCAAAAGAGAACTCGCCCGCAGCCATCCCCAGCGAAATCTGGGACAGC
CTGGCGCAGGAGTTTTCCATCTCCGACAGCCTGTCTAATCGCAGCAAGCCACAGCCGGCCAACCTGAATC
CGTTTGCCGAGGCACCGGCACCGGATCGCAATCCGGTGGATCCGCTGGCGCAGTTTGCCAGCAAGCCGGA
CAGCCTGAACTTCGATCGCCGCGATCAAACGCCGGATTCCCTGTTTACCGATGACGATGGCCTCTTTAAG
CAGGACAGCATCTTCAATGACAGCACGCCAAGCACCCTGATGCAGCAGCCTGCGGCTCAGCCTCAGCAGC
CGGGGAAAGGGAAAGATGAGCTGGATCCGCTGGCCCTGTTCGGTGGCAGCGGCGGTGGTGCACCGGCTCA
GGCCAACAGCGACGATCCGCTGGGCCTGATGATGGGCAATGCCGTACCGCTAACGCCGATGGATGCGTCA
GGCAGCCAGCCGCGTCCGGCGACGCAGCAGCCTCCGCAGCACACCATCGTGCCGCCAGCGCCGCACGCGC
TGGATAGCGACTTCGATCTGTTTGCCGGTGACAAATCCAATACGCAGCACGCTTCGCCGCTGTTTGATGA
TGCGCCACAGCATGGCGACGAAACGCCGTCACGGTCAGCTGACTCCCCGGCGGACCTTGCTGACTCGCCG
TTGTTTGATCAGCCGCCGACGGCCGCTCAACCGGATTACGGCGGCATCACGCTGCCCACGCCGCAGGCGG
TGGCCCGTAATACCACGCCGCCGCCAAAAGGCCGTCTGCGCATCGATCCTGTTTCCAATACGGCTTCACA
GCAGTCGTCGTCATCGGCCTCCAGTGGCCAGGTGCTGGACGGTGAACTGCTGGACGCATTAATCGGCGGC
ATGGGGCTCAACGATCTGCAACCGACGCCGCGCATCGATCGCGATTCCATGCAGGAACTTGGGCAGATGC
TCAGCATGTTCTCGCAGGGGACCGTGGCGCTGCTCTCTTCCCGTTCGATCCTCAAGCGCGGCGTGAAGGC
AGAAATGACGGTGATCCTCGACGAGGCGAACAACCCGTTCAAACTATTGCCGTCAGGTAAATCGGTGCTG
ATGCAGATGTTCGGCAGCCGCATGCCGGGCTTTATGCCGCCGAAACAGTCGGTGCGCGATGCGCTGGTCG
ATCTGCAGGCGCACCAGTTGGGGATGATCGCCGGGATCCGCGCGATCATCGCTTCGATGTTGCAATCCTT
TAATCCTCAGCAGCTGGAAGAGGAAGCGAAGCAGGAAGGGATCACCTCGCGCATCTCCTTGCCGAGCAGC
CGCAAAGCCGCGCTGTGGGAACACTTCACCAAACGCTATGGCGAAACCGCCGGTGAAATCGAAGACGACT
TCCATACCCTGTTTGGCGAGGCGTTTCTGCATGCCTATGACATGGAAGTGAACCAGTACAAAGACTCTCA
AATCAGATCGGAAGAATGA
 Primer design