SecReT6
Protein ID: 300715179
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05910
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]696173..696991 [+]
Productvirulence protein, SciE type family protein
NoteTagJ
UniProt IDD8MMR5
KEGG IDebi:EbC_05910
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.00E-40, Aligned region: 146..268
Protein Sequence: 272 a.a.     [Download]
>gi|300715179|ref|YP_003739982.1| unnamed protein product [Erwinia billingiae Eb661]
MYSLSTLMSGASLAETLARVEGKIKANPADADLRAAFVQLLCLAGNWTRATTQMKSWAALKPQAKPTVTL
LEQAVAGEVQRAAVFAGEASPMMPGDAFNWAEGLLSALRADAAGKNLLADELRAAAFEAAEINPGSLKQL
KDESAQAVDWLIDGDGRLGPICELIVNGRYTWLPFSAISELRFQAPASVTDLVWRHTSVRLTDGSEQVCQ
IPVRYPFGAEAADNLLLASVTEWQPLDGAGLHFSGLGQKTWLSGEADYPLLSLDVLTFDEAL
 
Nucleotide Sequence: 819 bp     [Download]
>gi|300714588|ref|NC_014306.1|:696173-696991 Erwinia billingiae Eb661 chromosome, complete genome
ATGTACTCCCTCAGCACCCTGATGTCCGGCGCCTCGCTTGCGGAAACGCTGGCGCGCGTCGAAGGCAAAA
TTAAAGCCAACCCGGCGGATGCCGATTTGCGCGCGGCCTTCGTGCAACTGCTGTGCCTGGCTGGAAACTG
GACGCGCGCCACCACCCAGATGAAATCCTGGGCGGCGTTGAAGCCACAGGCCAAACCGACGGTGACGTTG
CTGGAGCAAGCGGTGGCGGGAGAAGTGCAGCGCGCGGCGGTGTTTGCCGGCGAGGCCTCGCCGATGATGC
CTGGCGACGCCTTTAACTGGGCCGAAGGGTTGTTAAGCGCGCTGCGGGCCGATGCGGCGGGCAAAAACCT
GTTGGCTGACGAGCTGCGTGCGGCGGCGTTCGAGGCGGCTGAAATCAATCCCGGCAGCCTGAAGCAGTTG
AAGGATGAGTCAGCGCAGGCGGTCGATTGGTTGATTGATGGCGATGGCCGCCTTGGCCCAATCTGCGAGC
TGATCGTCAACGGGCGCTACACCTGGCTGCCGTTCAGCGCCATCAGCGAACTGCGTTTTCAGGCACCGGC
CAGCGTGACCGATCTGGTCTGGCGTCATACCTCGGTCAGGCTGACCGACGGCAGCGAGCAGGTGTGTCAG
ATCCCGGTGCGCTATCCGTTTGGCGCTGAAGCCGCTGATAATCTGCTGCTGGCCAGCGTCACCGAATGGC
AGCCGCTGGATGGTGCCGGTCTGCACTTTAGCGGACTGGGGCAGAAAACCTGGCTGAGCGGCGAAGCGGA
CTATCCGTTGCTGAGCCTGGACGTGCTGACCTTCGACGAGGCGCTATGA
 Primer design