SecReT6
Protein ID: 300715180
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05920
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]696988..697569 [+]
Producttype VI secretion system, lysozyme-related family protein
NoteTssE
UniProt IDD8MMR6
KEGG IDebi:EbC_05920
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.90E-19, Aligned region: 62..172
Protein Sequence: 193 a.a.     [Download]
>gi|300715180|ref|YP_003739983.1| unnamed protein product [Erwinia billingiae Eb661]
MSNDFDLNQPQQGSDLLRGGYRHRNKQEALNARDKMQPSLLDRLTDNAPDKLKESASNTVISHTTLRRHV
LRDLQWLFNSINNEGQQDLEPFAEVKRSVLNYGVAPLSGQRMSDIEWQDVQRKLTNSILDFEPRILPVGL
QVRCISDTTSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFEFKDVG
 
Nucleotide Sequence: 582 bp     [Download]
>gi|300714588|ref|NC_014306.1|:696988-697569 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGCAATGACTTCGACCTGAATCAACCGCAGCAGGGCAGCGATCTGCTACGCGGTGGCTACCGTCACC
GCAACAAGCAGGAAGCGTTAAACGCCCGCGACAAAATGCAGCCTTCACTGCTGGATCGGCTGACCGATAA
CGCACCGGACAAGCTGAAAGAGTCCGCCAGCAACACGGTGATTTCCCACACCACGCTGCGGCGGCATGTG
CTGCGGGATTTGCAGTGGCTGTTTAACAGCATCAATAACGAAGGGCAGCAGGACCTGGAGCCCTTCGCCG
AGGTGAAGCGCTCGGTGCTGAACTATGGCGTGGCGCCACTTTCCGGGCAGCGCATGTCCGACATCGAGTG
GCAGGACGTGCAGCGCAAGCTCACCAACTCGATCCTGGATTTTGAGCCGCGCATTTTGCCGGTGGGTTTA
CAGGTGCGCTGCATTTCAGACACCACCTCGCTGGACCTGCACAACGTGTTGTCGATTGAAATCAAGGGGC
GGCTGTGGTGCGTACCCTATCCGCTGGAATTCCTGTTCCGCACCGATGTCGACCTGGAAAACGGCCATTT
TGAGTTTAAAGACGTAGGGTAA
 Primer design