SecReT6
Protein ID: 300715181
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05930
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]697572..699449 [+]
Producttype VI secretion system, VCA0110 family
NoteTssF
UniProt IDD8MMR7
KEGG IDebi:EbC_05930
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-211, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|300715181|ref|YP_003739984.1| unnamed protein product [Erwinia billingiae Eb661]
MDSKLLDYYNRELAYLREMGAEFAERYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRMLEMIAPNYLAPTPSMAIAELHPDSQKGDISGGFRVPRGTMMDSQTLKKSGVTCSYSTAHDVMLQP
LTITSVELGGVPADIPLGPMGLSQRGAASALRIRLTCFNDVTLNTLTFDDLMFFLSGPDIQAQKLLELIM
QHTVGSFCQTVEAQPQRVVMNDEALTQEGFSPDQALLPDDLRNFDGYRLLQEYFAFPARFQFINISQLRG
ILGKCGPDVKAFEIVLLLDKADAALERVIDKSHLSLHCTPVINLFPKTAERQKISDSVHEYHLVVDNIRP
LDYEIYSVQKLYATGDKRRDEQVFRPFWSTFSQDHGDYGAYFSLRREQRTLSERAQRYGTRTGYVGSEVF
LSLVDERHSPWSDDLRHLTADVLCTSRDLPLMLLQQDQGNFLMPDSIPVGQLTLKKGPTPPRPALAEGLT
TWRLISHLQMNYLSLMDSDEGQGAAALRQLLGLYANLAEAPVARQIEGIRHCQLKPVYRRVPEPGPIVFA
RGVGIELSVDEQAFSGSSPWLLGSVLERVFSRLVAMNSFTEVTLISQQRGEVGYWSPRMGKRALI
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|300714588|ref|NC_014306.1|:697572-699449 Erwinia billingiae Eb661 chromosome, complete genome
ATGGACAGTAAACTGCTCGATTATTACAACCGTGAACTGGCGTACCTGCGCGAAATGGGGGCGGAGTTTG
CCGAACGCTACCCAAAAGTCGCCGGACGGCTGGGGATGCGCGGGATTGACGTCGCCGATCCGTATGTCGA
GCGGCTGATGGAAGGCTTTGCCTTTCTGACCTCCCGCGTGCAGTTAAAAATGGATGCCGAGTTCCCGCGT
TTCTCCCAGCGGATGCTGGAGATGATTGCGCCAAACTACCTGGCCCCTACGCCGTCGATGGCGATTGCGG
AGCTGCATCCGGACAGCCAGAAAGGCGACATCAGCGGCGGCTTTCGCGTCCCGCGCGGCACGATGATGGA
CAGCCAGACGCTGAAGAAAAGCGGCGTCACCTGCAGCTACAGCACCGCCCACGATGTGATGCTACAACCG
CTGACCATCACCAGCGTCGAGCTGGGCGGCGTGCCGGCGGATATCCCGCTGGGGCCGATGGGCCTCAGCC
AGCGCGGAGCCGCCAGCGCGCTACGCATCCGCCTGACCTGTTTCAACGACGTAACCCTGAACACCCTGAC
CTTTGACGATCTGATGTTCTTCCTCAGCGGCCCGGATATTCAGGCGCAAAAGCTGCTTGAGCTGATTATG
CAACACACGGTGGGCAGCTTCTGTCAGACGGTGGAAGCGCAGCCGCAGCGGGTGGTGATGAACGATGAGG
CGCTGACCCAGGAAGGATTTTCGCCTGACCAGGCCTTGCTGCCGGACGATCTGCGCAACTTCGACGGCTA
CCGGCTGTTGCAGGAGTACTTTGCTTTTCCGGCCCGTTTCCAGTTCATCAACATCAGCCAGCTGCGCGGC
ATTCTCGGCAAGTGCGGCCCGGATGTTAAAGCGTTTGAGATCGTGCTGCTGCTGGATAAAGCCGACGCGG
CGCTGGAAAGGGTGATCGATAAAAGCCATCTGTCGCTGCACTGCACGCCGGTGATCAACCTGTTCCCGAA
GACGGCCGAGCGGCAAAAAATCAGCGACAGCGTGCATGAATATCATCTGGTGGTCGACAATATTCGCCCG
CTGGATTACGAGATTTACTCGGTTCAAAAGCTGTATGCCACCGGCGATAAGCGCCGTGACGAACAGGTTT
TCCGCCCGTTCTGGAGCACCTTCAGCCAGGACCACGGGGATTACGGTGCCTATTTCTCGCTTCGCCGCGA
ACAGCGCACGCTGTCTGAGCGCGCGCAGCGTTACGGCACGCGGACCGGCTATGTCGGCTCGGAAGTTTTC
CTGTCGCTGGTGGATGAACGTCATTCCCCGTGGAGCGATGATCTGCGCCATCTGACCGCCGACGTGCTGT
GCACCAGCCGCGATCTGCCGCTGATGCTGCTGCAACAGGATCAGGGCAACTTCCTGATGCCGGACTCGAT
TCCGGTCGGTCAGTTAACGCTGAAGAAAGGGCCAACGCCACCGCGTCCGGCGCTGGCCGAAGGGCTGACG
ACCTGGCGCTTGATCAGCCATCTGCAAATGAACTACCTCAGCCTGATGGACAGTGATGAGGGACAGGGCG
CTGCCGCGCTGCGTCAGCTGCTGGGGCTGTATGCCAATCTGGCGGAAGCGCCGGTGGCGAGGCAGATCGA
AGGCATCCGCCACTGTCAGTTAAAGCCGGTGTATCGCCGGGTGCCGGAACCTGGTCCGATCGTCTTCGCG
CGGGGCGTGGGCATCGAACTGAGCGTGGATGAACAGGCGTTCTCCGGTTCAAGCCCGTGGTTACTGGGCA
GCGTGCTGGAGCGGGTCTTTTCGCGGCTGGTGGCGATGAACAGCTTTACCGAAGTGACGCTGATCAGTCA
GCAGCGCGGTGAAGTGGGTTACTGGTCGCCAAGGATGGGCAAAAGGGCGCTGATATGA
 Primer design