SecReT6
Protein ID: 300715182
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05940
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]699446..700510 [+]
Producthypothetical protein
NoteTssG
UniProt IDD8MMR8
KEGG IDebi:EbC_05940
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-111, Aligned region: 29..331
Protein Sequence: 354 a.a.     [Download]
>gi|300715182|ref|YP_003739985.1| unnamed protein product [Erwinia billingiae Eb661]
MSDATVPSTLRFRKIQRLPEHFWQGVTLAPWRYDLFQLLRRLDAQGGERYPLGRAPLPRHEPLRIGQTPS
LAFAPSTLASASARENSPLHDVSILSFGLFGPNGPLPVHLTEYARERIYHHQDHSLSAFADLFHHRLTLL
FYRAWADAQPTVSLDREDAHHFERYLASLIGMGQPGQLEKGSLSEHARYTVAGHLTRNGRDAEGLQKILS
HYFKVPVTLVENVPHWQPIDRRERAQLGAGRRMPTLGQSAFLGVAVRDVQHKFRIELGPLSLANYNRFLP
GTPWAQQLRDWVRQYLGIEYVWDLRLILAAEDVQGVSLGGPAQLGYNGWLGCPENPQPRNDLTFSPEPTE
TPGI
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|300714588|ref|NC_014306.1|:699446-700510 Erwinia billingiae Eb661 chromosome, complete genome
ATGAGTGATGCGACGGTACCATCGACGTTACGATTCCGCAAAATCCAGCGGCTGCCGGAACATTTCTGGC
AAGGCGTGACGCTGGCACCCTGGCGCTACGATCTGTTCCAACTGCTGCGGCGGCTGGATGCGCAGGGCGG
AGAACGCTATCCGCTGGGACGGGCGCCGCTGCCTCGCCACGAGCCGCTGCGTATTGGTCAGACGCCTTCG
CTGGCCTTCGCACCCTCGACGCTCGCCAGCGCCAGCGCGCGTGAGAACAGCCCGCTGCACGATGTCTCGA
TCCTCAGCTTCGGCCTGTTCGGCCCCAACGGCCCGCTGCCGGTTCACCTGACCGAATATGCGCGCGAGCG
CATTTATCATCACCAGGATCACAGCCTGAGCGCCTTTGCGGATCTGTTCCATCATCGCCTGACGCTGCTG
TTTTATCGTGCCTGGGCCGATGCGCAGCCGACGGTGTCGCTGGACCGCGAGGACGCCCATCACTTTGAAC
GCTATCTGGCCAGCCTGATTGGCATGGGCCAGCCCGGCCAGCTGGAAAAAGGCAGCCTCAGCGAACACGC
GCGCTATACGGTGGCCGGGCACTTAACCCGCAACGGGCGCGATGCCGAAGGATTGCAAAAAATCCTCAGC
CACTATTTCAAGGTGCCGGTCACGCTGGTGGAAAACGTGCCGCACTGGCAGCCGATCGATCGCCGCGAGC
GCGCGCAGCTGGGTGCCGGACGGCGGATGCCGACACTGGGGCAGTCCGCCTTTCTCGGCGTCGCAGTGCG
CGATGTGCAGCATAAATTTCGCATCGAACTGGGGCCGCTGAGCCTGGCAAATTACAACCGGTTTTTGCCC
GGCACACCCTGGGCACAGCAGCTGCGCGACTGGGTTCGGCAGTATCTGGGCATCGAATACGTCTGGGACC
TGCGGCTGATCCTGGCGGCGGAAGACGTGCAGGGCGTCAGCCTCGGTGGCCCGGCTCAGCTGGGCTACAA
CGGCTGGCTGGGTTGCCCTGAAAATCCGCAGCCGCGTAACGATCTGACCTTCAGCCCTGAACCGACTGAA
ACCCCTGGGATTTAA
 Primer design