SecReT6
Protein ID: 300715183
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05950
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]700567..703179 [+]
Producttype VI secretion system ATPase, ClpV1 family protein
NoteTssH
UniProt IDD8MMR9
KEGG IDebi:EbC_05950
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 222..243
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 601..766
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 222..355
AAA [PF00004], Evalue: 1.70E-20, Aligned region: 607..691
ClpB_D2-small [PF10431], Evalue: 9.80E-17, Aligned region: 774..849
AAA_5 [PF07728], Evalue: 6.00E-13, Aligned region: 222..299
AAA_5 [PF07728], Evalue: 6.00E-13, Aligned region: 606..726
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 34..77
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 266..301
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 469..530
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 603..651
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 222..302
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 368..388
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 605..630
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 668..689
Sigma54_activat [PF00158], Evalue: 3.90E-07, Aligned region: 208..237
Sigma54_activat [PF00158], Evalue: 3.90E-07, Aligned region: 606..722
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 222..302
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 328..389
AAA_14 [PF13173], Evalue: 1.60E-06, Aligned region: 605..716
NACHT [PF05729], Evalue: 4.20E-06, Aligned region: 222..318
NACHT [PF05729], Evalue: 4.20E-06, Aligned region: 607..633
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 221..246
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 275..319
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 471..495
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 597..628
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 221..245
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 604..628
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 222..264
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 482..523
AAA_17 [PF13207], Evalue: 1.70E-05, Aligned region: 606..642
IstB_IS21 [PF01695], Evalue: 2.80E-05, Aligned region: 207..241
IstB_IS21 [PF01695], Evalue: 2.80E-05, Aligned region: 606..626
IstB_IS21 [PF01695], Evalue: 2.80E-05, Aligned region: 717..739
Zeta_toxin [PF06414], Evalue: 7.30E-05, Aligned region: 221..242
Zeta_toxin [PF06414], Evalue: 7.30E-05, Aligned region: 600..656
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 222..242
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 608..631
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 796..856
AAA_29 [PF13555], Evalue: 0.00039, Aligned region: 214..238
AAA_29 [PF13555], Evalue: 0.00039, Aligned region: 604..631
Clp_N [PF02861], Evalue: 0.00059, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.00059, Aligned region: 107..123
Clp_N [PF02861], Evalue: 0.00059, Aligned region: 309..319
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 201..236
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 275..306
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 352..396
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 605..645
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 607..628
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 704..725
FtsK_SpoIIIE [PF01580], Evalue: 0.0032, Aligned region: 215..265
FtsK_SpoIIIE [PF01580], Evalue: 0.0032, Aligned region: 466..508
FtsK_SpoIIIE [PF01580], Evalue: 0.0032, Aligned region: 606..624
RuvB_N [PF05496], Evalue: 0.0061, Aligned region: 220..239
RuvB_N [PF05496], Evalue: 0.0061, Aligned region: 278..302
RuvB_N [PF05496], Evalue: 0.0061, Aligned region: 574..627
RuvB_N [PF05496], Evalue: 0.0061, Aligned region: 675..699
SRP54 [PF00448], Evalue: 0.0071, Aligned region: 221..242
SRP54 [PF00448], Evalue: 0.0071, Aligned region: 450..484
SRP54 [PF00448], Evalue: 0.0071, Aligned region: 605..639
T2SE [PF00437], Evalue: 0.0072, Aligned region: 207..239
T2SE [PF00437], Evalue: 0.0072, Aligned region: 603..683
Protein Sequence: 870 a.a.     [Download]
>gi|300715183|ref|YP_003739986.1| unnamed protein product [Erwinia billingiae Eb661]
MSEISRAVLFGKLDKLLFTSLESATAFCKLRGNPYVELVHWLHQLMQHQEGDLQQAIRHFSLDEEALTRD
IVAALDRLPRGASAVADLSEHIDSAVERAWVYGSLKFGVQKIRGGHLLIGMLKTFNLANLLKGISPQFGR
ISVDALLEQFDTVFANSKEEQQVSVAPVDAGAVPQQQGTLAQYAQDLTARAREGKIDPVAGRDEEIRQMV
DILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPQPLQDVQLWLLDIGMLQAGAGMKGEFEARLQA
LINEVQSSPTPIVLFIDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALTR
RFQTVQVQEPDEEKALLMLRSTVSPLEKHHRVLLLDEAVAAAVKLSHRYIPARQLPDKAVALLDTACARV
AVSQSAQPPQLEDCLHRIHALEIEKEIAGRELKVGIGDSARVDALSEQLAELATQAEALTARWQAERELV
DGIIALRAQLHQDNAEDVAELHATLKDRQQQLKDLQGESPLLFAAVDANVVAAVVSDWTGIPLGRMVKNE
IDAVLKLADTLNERVIGQRHGLDLIAKRVRTSRARLDDPNKPVGVFMLCGPSGVGKTETALALAETLYGG
EQNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFD
KGWMEDGEGRHIDFRNTIIILTSNVGTQLISAMCADPELMPDPDALAAALRPPLLEVFPPALLGRLLVVP
YYPLSDEMLASIVRLQLKRIQRRLEQNHGIVSEVDDSVIAQIVQRCTEVESGGRMVDAILTNTLLPQMSQ
MLLTASARDEQYRRLRVTLQQGEFQCQFEA
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|300714588|ref|NC_014306.1|:700567-703179 Erwinia billingiae Eb661 chromosome, complete genome
ATGTCAGAAATCAGCCGCGCCGTACTGTTCGGCAAACTGGACAAGCTGTTATTCACCTCTCTGGAAAGTG
CGACCGCGTTCTGCAAACTGCGCGGCAATCCCTATGTTGAACTGGTGCACTGGCTTCATCAGCTGATGCA
GCATCAGGAGGGCGATCTGCAACAGGCGATCCGCCATTTCTCGCTGGATGAAGAGGCGCTGACGCGGGAT
ATCGTGGCGGCGTTGGATCGCCTGCCGCGCGGGGCCAGCGCCGTCGCCGATCTGTCGGAACATATCGACA
GCGCCGTCGAGCGCGCCTGGGTTTACGGTTCCCTGAAATTCGGCGTGCAGAAAATTCGTGGCGGCCATCT
GCTGATCGGCATGCTGAAAACCTTCAACCTTGCCAATTTGCTGAAGGGCATCTCGCCGCAGTTTGGTCGC
ATCAGCGTGGACGCGCTGCTGGAACAGTTCGACACCGTTTTTGCCAACAGCAAAGAGGAACAGCAGGTGA
GCGTCGCGCCGGTTGATGCCGGTGCGGTTCCTCAGCAGCAGGGCACGCTGGCGCAATATGCCCAGGACCT
GACCGCACGGGCGCGCGAAGGCAAGATTGACCCGGTGGCCGGGCGTGATGAAGAGATCCGCCAGATGGTC
GACATCCTGATGCGTCGTCGCCAGAACAACCCGCTACTGACCGGGGAAGCCGGGGTCGGTAAAACCGCGG
TGGTGGAAGGGCTGGCGCTGCGCATTGCCGCAGGCGACGTGCCGCAACCGTTGCAGGACGTGCAGCTGTG
GCTGCTGGATATCGGCATGTTGCAAGCCGGTGCCGGCATGAAGGGCGAGTTTGAAGCGCGTCTGCAGGCC
TTGATCAACGAGGTGCAGTCGAGCCCAACGCCGATCGTGCTGTTTATCGACGAGATCCACACGCTGGTCG
GCGCGGGCGGACAGCAGGGAACCGGTGATGCCGCTAACCTGCTGAAACCGGCGCTGGCACGCGGTCAGCT
TCGCACCATTGGTGCCACCACCTGGGCCGAATACAAAAAATACATCGAGAAAGATCCGGCGCTGACCCGC
CGTTTCCAGACCGTGCAGGTGCAGGAGCCGGATGAAGAGAAGGCGCTGCTGATGTTGCGCAGCACCGTCA
GCCCGCTGGAAAAGCATCACCGCGTCCTGCTGCTGGACGAAGCGGTTGCCGCGGCGGTGAAACTGTCGCA
CCGCTATATTCCTGCGCGTCAGTTGCCGGATAAAGCCGTGGCGCTGCTGGATACCGCCTGCGCCCGCGTC
GCCGTCAGCCAGAGCGCTCAGCCGCCGCAGCTGGAAGACTGCCTGCACCGCATCCACGCGCTGGAAATCG
AAAAAGAGATTGCCGGACGCGAGCTGAAAGTCGGCATTGGCGACAGCGCGCGCGTTGATGCGCTAAGCGA
ACAGCTGGCCGAACTCGCCACGCAGGCTGAAGCACTAACCGCCCGCTGGCAGGCCGAGCGCGAGCTGGTC
GATGGCATCATCGCCCTGCGTGCTCAGCTGCATCAGGACAATGCCGAAGATGTGGCTGAACTGCATGCCA
CGCTGAAAGACCGTCAGCAGCAGTTAAAGGATCTGCAGGGCGAATCGCCGCTGCTGTTTGCCGCCGTGGA
TGCCAACGTGGTTGCGGCAGTGGTTTCCGACTGGACCGGCATCCCGCTAGGCCGCATGGTAAAAAACGAG
ATTGATGCGGTGCTGAAGCTGGCGGATACGCTGAACGAGCGGGTGATTGGTCAGCGTCACGGGCTGGATC
TGATTGCTAAGCGGGTGCGGACGTCGCGCGCCAGACTCGACGATCCCAACAAGCCGGTCGGCGTGTTTAT
GCTCTGCGGCCCGTCGGGCGTCGGTAAAACCGAAACCGCACTGGCCCTGGCCGAGACGCTGTACGGCGGC
GAGCAGAACATTATCACCATCAATATGAGTGAATTCCAGGAAGCGCATACCGTCTCGACCCTGAAAGGGG
CACCGCCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGTTAACCGAAGCCGTCCGCCGTCGGCCTTACAG
CGTGGTGCTGCTCGACGAGATCGAAAAAGCGCACCCGGACGTGCATGAAATCTTCTTCCAGGTGTTCGAC
AAAGGCTGGATGGAAGACGGTGAAGGACGTCATATCGACTTCCGCAACACCATTATCATTTTGACCTCCA
ACGTCGGCACCCAGCTGATTAGCGCGATGTGCGCCGATCCTGAATTGATGCCGGATCCCGATGCACTGGC
CGCTGCGCTACGTCCTCCGCTGCTGGAGGTCTTCCCGCCCGCGCTGTTGGGCCGTCTGCTGGTGGTGCCG
TATTACCCGCTCAGCGACGAAATGCTGGCCAGCATTGTTCGCCTGCAGCTGAAGCGCATCCAGCGTCGCC
TGGAGCAGAACCACGGCATTGTTTCCGAGGTGGACGACAGCGTGATTGCCCAGATTGTGCAGCGCTGCAC
CGAGGTGGAATCCGGTGGTCGCATGGTTGACGCCATCCTAACCAATACCCTGTTGCCGCAGATGAGCCAG
ATGTTGCTCACCGCCAGCGCACGGGATGAACAGTATCGCCGCCTGCGTGTGACCTTACAGCAGGGCGAAT
TCCAGTGTCAGTTTGAGGCTTAA
 Primer design