SecReT6
Protein ID: 300715185
SecReT6 ID402
T6SS typei3
Gene symbol-
Locus tagEbC_05970
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]704738..706663 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDD8MMS1
KEGG IDebi:EbC_05970
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-76, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 3.40E-24, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 9.80E-07, Aligned region: 501..523
Protein Sequence: 641 a.a.     [Download]
>gi|300715185|ref|YP_003739988.1| unnamed protein product [Erwinia billingiae Eb661]
MLDRITVQLPMDGLLFWKLNGTEALSSAFEITVQLLSTDARIERKALLGQPITVSIPTQNLMATRYLNGK
ITKVSVSSTELSGTRYAVYSLVMEPDLWPLKRDRNLRIFQSQTVTQIIKTLLSEYNVTVEDKLTGNYRVW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADKHTMVLMDSAQQHQPFSGYETIPYHVTPSGGSTSEEGI
SLWSLEDQVTPGLYSIDDYDFRKPNAWMFQARQNPASPSPGQIDVYDWPGHFIDHDHGEFYARIRQEVWQ
AQHQQVTASGTALGLAPGNTFTLLNAPFFSDNGEYLTIKAVYDFEENSYASSNSGSTIHKVDIVVIPSDV
TFRPQPTAEWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVNDEVVIDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFLSRSKDGSPDNANALRFEDKAG
EEQVWIQAQKNMDTHVKADETQTVGGNQTISVEKALSSTVSGTYDQKTQWTRSELVGSDYVLKVQGGMVL
ASGEGISLVSGDSMLTLMPNGTISLQCKQFQINASGQAEINTGGTLDLNINVPGTAAQPSPTPDEIKNDV
MEAFQNKGSSK
 
Nucleotide Sequence: 1926 bp     [Download]
>gi|300714588|ref|NC_014306.1|:704738-706663 Erwinia billingiae Eb661 chromosome, complete genome
ATGCTTGATCGCATTACAGTTCAACTGCCGATGGACGGCCTGCTGTTCTGGAAACTGAACGGCACGGAGG
CGCTTTCCAGCGCGTTTGAAATCACCGTCCAGCTCCTGAGCACCGACGCCCGCATTGAGCGTAAGGCCCT
GCTGGGGCAGCCCATCACTGTGTCCATCCCCACCCAGAACCTGATGGCAACCCGTTACCTGAACGGGAAA
ATCACTAAAGTGTCGGTCAGCAGCACCGAGTTGAGCGGCACGCGCTATGCGGTTTACAGCCTGGTGATGG
AGCCGGACCTGTGGCCCCTGAAGCGCGACAGAAACCTGCGCATCTTCCAGAGCCAGACGGTAACGCAAAT
CATCAAAACGCTGCTTTCCGAATACAACGTGACGGTAGAAGACAAGCTCACCGGCAACTACCGCGTGTGG
GAATACTGCGTGCAGTATCAGGAAAGCAGCTTTAACTTCATCAGCCGCCTGATGGAGCTGGAAGGAATTT
ACTACTACTTCCGCCATGAGGCGGATAAACACACCATGGTGCTGATGGACAGCGCGCAGCAGCATCAGCC
GTTCAGCGGCTACGAAACCATTCCGTACCACGTCACCCCGTCCGGCGGCTCGACCAGCGAAGAGGGCATC
AGCCTGTGGAGCCTGGAAGACCAGGTGACGCCGGGGCTTTACAGCATCGATGACTACGACTTCCGCAAGC
CCAACGCGTGGATGTTCCAGGCACGGCAGAATCCGGCCTCACCGTCGCCGGGTCAAATCGACGTCTACGA
CTGGCCGGGGCATTTTATCGACCACGACCACGGCGAGTTTTACGCCAGAATCCGCCAGGAAGTGTGGCAG
GCCCAGCACCAGCAGGTCACCGCCTCCGGCACCGCGCTGGGGCTGGCGCCGGGAAACACCTTCACCCTGC
TGAACGCGCCGTTCTTCAGCGATAACGGCGAATACCTGACGATTAAGGCCGTTTACGATTTCGAAGAGAA
CAGCTACGCCAGCAGCAACAGCGGCAGCACCATCCACAAGGTGGATATCGTGGTGATCCCGTCCGACGTC
ACCTTCCGGCCGCAGCCGACGGCAGAATGGCCGCGCACCCACGGCCCGCAGACGGCGAAGGTGGTGGGGC
CGAAAGGCGAATCGATCTGGACCGACAAATACGGCCGCATCAAGGTGAAGTTTCACTGGGACCGGCTGGC
AAAAGGCGACGACACCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGTCAGGGCTTCGGTGGC
GTGCAGATCCCGCGCGTCAACGACGAGGTGGTGATCGACTTTATCAACGGCGACCCGGACCGGCCGATCG
TCACCGGCCGGGTCTACAACGAAGCGAGCATGCCGCCGTGGGCACTGCCGGCAGCGGCCACCCAGATGGG
CTTCCTCAGCCGCTCGAAGGACGGTTCGCCGGACAACGCCAACGCCCTGCGCTTTGAAGATAAGGCCGGG
GAAGAGCAGGTGTGGATCCAGGCGCAGAAGAACATGGATACCCATGTGAAGGCGGATGAAACGCAAACCG
TCGGTGGCAATCAGACCATCAGCGTGGAAAAAGCCCTCAGCAGCACCGTGTCCGGGACTTACGATCAGAA
AACACAGTGGACGCGCAGTGAGCTGGTCGGCAGTGATTACGTGCTGAAGGTGCAGGGAGGAATGGTGCTG
GCCTCCGGGGAAGGTATCAGTCTGGTATCGGGCGACAGCATGCTCACGCTTATGCCGAACGGCACCATAT
CCTTGCAGTGCAAACAGTTCCAAATCAATGCCAGCGGGCAGGCTGAAATCAATACCGGCGGGACGCTCGA
CCTCAATATTAATGTGCCGGGCACGGCGGCTCAGCCCTCGCCAACTCCGGATGAAATCAAAAATGACGTT
ATGGAAGCATTTCAGAATAAAGGGAGCAGCAAATGA
 Primer design