SecReT6
Protein ID: 300718514
SecReT6 ID403
T6SS typeN/A
Gene symbol-
Locus tagEbC_39390
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]4390795..4393893 [+]
Producttype VI secretion system, ImcF domain-containing protein
NoteTssM
UniProt IDD8MXB3
KEGG IDebi:EbC_39390
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.40E-45, Aligned region: 229..268
IcmF-related [PF06761], Evalue: 8.40E-45, Aligned region: 390..683
DUF1215 [PF06744], Evalue: 5.30E-26, Aligned region: 62..111
DUF1215 [PF06744], Evalue: 5.30E-26, Aligned region: 771..893
Protein Sequence: 1032 a.a.     [Download]
>gi|300718514|ref|YP_003743317.1| unnamed protein product [Erwinia billingiae Eb661]
MNKFIRALGILLLLLAIAVVVIGMISQYGVFSSSGKGAGILISLLAIVPIVAVIAVFLSLATTSASWRAP
VRPNSTQAGDDSDRPVVKASIDFISLKSTLQHHFGKRWKRKLPWLLVMGRVDDVDQVAPGLTESGWMTVG
STVLLWGGSLAAGGNPADLQALRRLRRYAPADALIWVSQEAHYSQPVQADSALRGYEFVRHQLRWEMPVY
LLDRSEDLWPQPERPVQLAGVLQNKRLTPESLSSYVQSLLPALRVRGMAQISKNLSHAFLLQLACDLKAR
LPRWIDGFKPLLNSYCPMPLYGVVFSPSLKLRAYGPHERADSPVWRELSAGICRQAGRPVGLTLRAVTQW
GVALAVLVFALGTLVSGISNYRLVSRSLEHVQQTKTSPSPEALHSLQQTLQTLLTQQQQGTPLYRRFGLD
TTDALLPALWPEYSALAQRLIVQPAQQQLHAMLMLPRPDYDALKTYLMLAQPDKAAGEVAQRYLAQQLTP
LLKNVAPQDITFMTAHFARHPEWKITPDNGVVTQARSARLNAMSGADEEQKLYASLIYRASLNYVNLSLT
QLLDGQETGGMFTLGADVPGIFTRQAYEGAIAPEIAALVTRRQEQVGWVLAEPGHPLETARSPAAFGERL
TARYFAEYGTAWQKTLNQLKAHTVADPVAQLTLASDVSRSPQIALMKQLAWQGLAGPDERRGELHPALEP
VFAGIVSMATGAGKRNGITLSAWRSQTAGLRDRMRSLSSATGGTAALSQSVFRGTQIDNSVAELPARLRA
QLGSGWQPMAQALFLAPLSQTWKGVMSTGVKGMDAQWQQQIAAAWHKEFDHTFPFADSPKDASLAALNDF
IHPQSGLIARFIRQHLNGVLEYKGNRWQKADKLPPGITVNAAFLNKLNQLDRVGHALNDSGWSFRFRLQA
GTARDVVRTELRIDGQKLTYFNQMPSWQAFQWPGDTYSPGASLVWSSVRAGARLYFDTRGVWGFYRLLKQ
ANVTQLDATHYQLRWIAQDGLPLNYRLAFSAGNDPLSLLKLEGFSFPNTIFR
 
Nucleotide Sequence: 3099 bp     [Download]
>gi|300714588|ref|NC_014306.1|:4390795-4393893 Erwinia billingiae Eb661 chromosome, complete genome
GTGAATAAATTCATCAGGGCACTGGGAATACTGCTCCTGCTGCTGGCTATCGCCGTCGTGGTGATCGGTA
TGATCTCGCAGTACGGCGTGTTTTCTTCGTCCGGAAAGGGTGCCGGCATTTTAATCTCCCTGCTGGCCAT
CGTGCCGATCGTCGCTGTTATTGCGGTCTTTTTATCCCTCGCCACCACGTCGGCCAGCTGGCGAGCGCCG
GTTCGTCCGAATAGCACACAGGCGGGTGACGATTCGGATCGCCCTGTTGTAAAAGCGTCAATTGATTTCA
TAAGCTTGAAATCAACACTCCAGCACCACTTCGGCAAGCGCTGGAAACGCAAACTCCCCTGGCTGCTGGT
AATGGGGCGTGTGGATGATGTAGATCAGGTCGCGCCGGGTCTGACTGAATCTGGCTGGATGACGGTCGGC
AGTACCGTGCTGTTATGGGGTGGTTCACTCGCGGCAGGTGGCAATCCGGCCGATCTTCAGGCGTTACGCA
GGCTGCGTCGCTACGCGCCTGCCGATGCGCTGATCTGGGTTAGCCAGGAAGCACACTATAGCCAGCCGGT
GCAGGCAGACTCCGCGCTTCGCGGCTATGAGTTTGTCCGCCACCAGCTGCGCTGGGAAATGCCGGTATAT
CTGCTGGATCGGTCTGAAGATCTCTGGCCGCAGCCAGAACGTCCTGTGCAGCTGGCTGGGGTATTACAGA
ACAAAAGACTGACGCCTGAATCTTTATCGTCCTACGTTCAATCTCTGCTTCCCGCGCTTCGTGTCCGTGG
CATGGCCCAAATCAGCAAGAACCTGAGCCATGCGTTTCTCCTGCAACTTGCCTGTGATTTAAAAGCCCGT
TTGCCCCGCTGGATTGATGGTTTCAAGCCTTTGTTGAATAGCTACTGTCCGATGCCTTTGTATGGCGTGG
TGTTTTCACCGTCGCTGAAGTTGCGGGCATACGGCCCGCATGAACGTGCTGACTCACCGGTCTGGCGCGA
GTTGTCTGCAGGTATTTGCCGCCAAGCCGGTCGTCCGGTCGGGCTAACGCTGCGTGCGGTGACGCAGTGG
GGAGTCGCTCTCGCGGTGCTGGTTTTTGCGCTGGGCACGCTGGTATCCGGCATCAGCAATTACCGGCTGG
TGAGCCGCAGCCTGGAGCATGTTCAGCAGACGAAAACCTCGCCTTCGCCTGAAGCTCTGCATTCGCTGCA
ACAGACTCTGCAAACCTTGCTGACTCAGCAGCAACAGGGTACACCGCTGTATCGTCGTTTTGGTCTGGAC
ACAACGGATGCGCTTCTCCCTGCGCTCTGGCCGGAATATAGCGCGCTGGCGCAACGGCTTATCGTGCAAC
CGGCGCAGCAACAGCTTCACGCCATGTTGATGTTACCCAGGCCTGACTATGACGCCTTGAAAACCTATCT
GATGCTGGCCCAGCCAGACAAAGCCGCCGGTGAAGTAGCGCAGCGCTATTTAGCGCAGCAGCTGACGCCG
TTGCTGAAAAACGTCGCGCCGCAGGACATCACTTTTATGACCGCGCATTTCGCCCGGCATCCTGAGTGGA
AAATCACGCCGGACAACGGGGTTGTCACCCAGGCGCGTTCGGCCCGACTCAATGCCATGAGCGGCGCTGA
TGAAGAGCAAAAGCTTTATGCCTCGCTGATTTATCGCGCCTCACTTAATTACGTAAACCTGTCGCTGACG
CAGCTTTTAGACGGTCAGGAGACGGGTGGCATGTTTACCCTCGGCGCCGACGTGCCGGGCATTTTCACGC
GGCAGGCATATGAAGGTGCCATTGCGCCGGAGATTGCCGCGCTGGTCACCAGGCGTCAGGAGCAGGTCGG
CTGGGTACTGGCAGAACCGGGACATCCGCTGGAAACCGCACGCTCACCCGCCGCTTTCGGTGAGCGCTTA
ACGGCGCGGTATTTTGCTGAATACGGGACCGCCTGGCAGAAAACGCTGAACCAGCTGAAGGCACATACGG
TGGCGGATCCGGTGGCACAGTTGACGCTGGCCTCCGACGTCAGCCGTTCACCGCAGATCGCGTTGATGAA
ACAGCTGGCCTGGCAGGGACTGGCGGGCCCGGACGAACGTCGGGGTGAACTGCATCCTGCCCTGGAGCCT
GTGTTTGCCGGCATCGTCTCGATGGCGACCGGCGCGGGGAAACGAAATGGTATTACGCTGTCTGCCTGGC
GGTCACAAACGGCCGGACTGCGCGACAGGATGCGCAGCCTGTCGTCGGCCACCGGCGGAACGGCGGCGCT
CTCACAGTCGGTATTTCGCGGTACGCAGATTGATAACAGCGTCGCTGAGTTACCCGCTCGCCTGCGTGCT
CAGCTCGGTAGCGGCTGGCAGCCAATGGCACAGGCGCTGTTTTTGGCTCCGCTGAGCCAGACATGGAAAG
GCGTAATGAGCACTGGGGTAAAAGGCATGGACGCGCAGTGGCAGCAGCAGATTGCCGCAGCATGGCACAA
AGAATTTGATCACACCTTCCCGTTCGCCGACAGCCCGAAAGATGCCTCTCTGGCCGCGCTAAACGATTTT
ATTCATCCGCAGAGCGGCCTGATTGCCAGATTCATCCGCCAACATCTGAACGGCGTACTGGAATACAAAG
GCAACCGCTGGCAGAAGGCGGACAAGCTGCCGCCGGGAATAACGGTGAACGCCGCCTTTCTTAACAAACT
GAACCAACTCGACCGCGTAGGCCATGCGCTTAACGACAGCGGCTGGAGTTTTCGTTTCAGGCTGCAGGCG
GGTACGGCGCGTGACGTGGTGCGGACCGAACTGCGCATCGACGGTCAGAAGTTGACGTACTTCAATCAGA
TGCCTTCATGGCAGGCATTTCAGTGGCCGGGCGATACCTATTCTCCCGGCGCATCGCTGGTGTGGAGCAG
CGTGCGGGCCGGTGCGCGACTTTACTTTGATACGCGCGGCGTCTGGGGATTTTACCGGCTGCTAAAGCAG
GCCAATGTCACGCAGTTGGACGCGACGCATTATCAGCTGAGATGGATTGCACAAGACGGTCTGCCGCTCA
ATTACCGGCTGGCCTTTAGCGCCGGTAACGATCCGCTCAGCTTGCTGAAGCTCGAGGGTTTCAGCTTTCC
CAACACCATTTTCCGCTAA
 Primer design