SecReT6
Protein ID: 300723439
SecReT6 ID398
T6SS typei3
Gene symbol-
Locus tagXNC1_2523
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]2473397..2477005 [+]
Producthypothetical protein
NoteTssM
UniProt IDD3VHD6
KEGG IDxne:XNC1_2523
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.40E-80, Aligned region: 206..479
IcmF-related [PF06761], Evalue: 1.60E-76, Aligned region: 526..833
IcmF-related [PF06761], Evalue: 1.60E-76, Aligned region: 838..892
DUF1215 [PF06744], Evalue: 1.10E-24, Aligned region: 630..659
DUF1215 [PF06744], Evalue: 1.10E-24, Aligned region: 927..1049
MMR_HSR1 [PF01926], Evalue: 0.0075, Aligned region: 143..259
Protein Sequence: 1202 a.a.     [Download]
>gi|300723439|ref|YP_003712744.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MLNALLSIITSRLLWSFLGITIISVIIWFLGPIISVGNIVPLKSMTIRIITIIFLLIIWILTKLAPRLYR
LWLNKKLENQLKIDRDGKTETKKNEQYIVLEKRFSDAAMLLKKAYFSGWFNKNKPRWTNVFSRQYIYQLP
WYLVIGAPNSGKTTALANSGLHFSLADYLGKPVFYNKHVKDDFNWWFTNHTVFLDTAGRYTTQNSSHHQD
TREWKKFIQLLKKYRARQPINGIIMTISVEDLLNPSAEARDKQAYTLSERLSELHEQLKIQIPIYLLITK
SDLLKGFTAYFSHFDKISREQIWGFNFPWENKQRYNLNEIFEQQYNELQLRLNAELPYILLNGHHSRQCA
ESYLFPQEVASLRTRLAQYLDIIFTRSGFGRPGYPRGLYFTSGTQEGKPFDNVMAHFNLKFKLPTDNDSH
SMSWRNENEISSSPPASQAYFLKSLLGNIFHEAGIASYNRWWIYRKRLLDGIGYLSLIAILVFVSNLFLT
SYTNNKNYLTEVQAKIPLLIQQGDELKKSAGDIYALLPFLNNLAHLDKSLNFSLDNPPLSYRMGLYSGEQ
ISGASQSLYRKALQTLLLPQVVKLITHQLYHDNGDDIEGTYNTLKAYQMLYQPEYYEGKFLHNWVMQYLK
GDLGTDITQKQLQQINQHLSQLLDNQVVTSPFIRDNNLIKQKQALISKIPPAKRAYHYLKNKLLNDPDLA
PVNLDTLAGPQAELVFSNINGTAFTDSIPGMFTPAGYQKGINKNLNTFLTTLYSQDSWVLGPYVRKLTIN
EIRSFVKQLYINDYISQWDQFLLNIRLNNIDNLEQRMRTARLLSSSDSPLRTLLINTSKNVTLNNGILNK
NSAAAKQFIPKQILSDNQQNTPEQELEKHFAQMTALAKTTKGKNNQNIPFDETLKNIGDLYQYLTDVQNA
IRTGMPFPPNNIITQLQTTSELLPMPFNSIIASLAVGASSDTQLSDVKNVAKHLSAEVGVFCHQAIANRY
PLTPKARTDIKPDDMARMFTPETGLMDMFFQKNLAKNVDTTTQKWQFMPGIDGQPILEGETLLKPFQQAL
IISHALFSGGTPTPSFHVMVYPISMDNNILNMILDIDGQKLQYSHGPKRSQLISWPGSGKTNQVNIQLNL
SDGTTASLSTSGFWALNRLLDHAQQLYHNGDTDDSAYADETGLKAIFNIRGHTVSLGFTPSSVFSPFNLP
SFSCPSEKILTL
 
Nucleotide Sequence: 3609 bp     [Download]
>gi|300721089|ref|NC_014228.1|:2473397-2477005 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGCTGAATGCACTCCTTTCTATCATCACCAGCCGATTGTTATGGAGTTTTCTTGGAATAACGATTATTT
CTGTGATTATCTGGTTTTTGGGCCCCATTATTTCTGTCGGTAATATCGTCCCTTTAAAATCAATGACGAT
ACGCATCATTACGATTATTTTTCTCTTGATAATATGGATCTTAACCAAATTAGCCCCTCGGCTGTACAGA
TTATGGCTCAATAAAAAGCTGGAAAATCAATTAAAAATTGATCGGGACGGGAAAACAGAAACGAAAAAAA
ATGAACAGTACATTGTATTGGAAAAACGTTTTTCTGATGCGGCAATGTTATTGAAAAAAGCCTATTTTTC
CGGTTGGTTCAATAAGAATAAGCCTCGCTGGACAAACGTGTTCAGCCGCCAATATATTTATCAATTACCT
TGGTATCTTGTTATCGGGGCACCCAATTCAGGTAAAACAACCGCTCTGGCAAATTCTGGCTTACACTTTT
CCCTGGCGGATTATCTTGGAAAACCCGTATTTTACAATAAACACGTGAAGGATGACTTTAATTGGTGGTT
TACTAATCATACCGTTTTCCTTGATACCGCTGGACGATATACCACCCAAAATAGTTCACACCATCAAGAT
ACCCGCGAATGGAAAAAATTTATTCAGTTGTTGAAAAAATACCGCGCCCGCCAGCCAATCAATGGGATCA
TCATGACGATCAGTGTGGAAGACTTACTGAATCCGTCAGCCGAAGCCCGGGATAAACAAGCGTATACCCT
GAGTGAACGTTTATCAGAATTACATGAACAACTTAAGATACAAATCCCTATTTACCTCTTAATCACCAAA
AGTGATTTATTAAAAGGATTTACCGCGTATTTCAGCCATTTTGACAAAATATCACGTGAACAAATCTGGG
GATTTAATTTCCCGTGGGAAAATAAGCAGCGATATAACCTGAATGAAATCTTTGAGCAACAATATAACGA
ACTGCAACTGCGACTCAATGCTGAATTACCCTATATTCTTTTAAACGGACACCACTCCCGCCAGTGTGCT
GAAAGTTATCTTTTCCCGCAAGAGGTCGCCTCCTTGCGTACACGCCTTGCACAATATCTTGATATCATAT
TCACACGATCAGGATTTGGAAGACCCGGTTATCCACGGGGATTGTATTTCACCAGTGGAACACAAGAAGG
AAAGCCATTTGATAATGTCATGGCACACTTTAACCTGAAATTTAAATTACCAACGGATAACGATAGCCAC
TCAATGTCATGGAGAAATGAGAATGAAATATCCTCTTCTCCTCCTGCCAGTCAGGCTTATTTTCTGAAGA
GTTTACTGGGAAATATCTTTCATGAAGCCGGAATTGCCAGTTATAACCGTTGGTGGATATACCGGAAACG
CCTGCTGGATGGAATAGGCTATCTTAGCCTGATAGCAATATTAGTCTTTGTCAGCAATTTATTTTTAACC
AGTTACACCAACAACAAAAATTACCTGACGGAAGTTCAGGCTAAAATTCCGCTGCTTATCCAACAAGGAG
ATGAATTAAAGAAAAGCGCCGGAGATATTTATGCCCTGCTGCCTTTTTTAAATAATTTAGCCCATCTGGA
TAAGAGCCTGAACTTTTCTTTAGATAATCCACCCCTATCTTATCGTATGGGGCTATACAGTGGTGAACAA
ATCAGCGGGGCAAGTCAATCTTTATACCGAAAAGCATTGCAGACTTTGTTGCTGCCACAAGTGGTAAAGC
TAATCACTCATCAACTGTATCATGACAACGGGGATGATATAGAAGGAACCTACAATACGCTGAAAGCGTA
CCAAATGTTATATCAGCCTGAATATTATGAGGGTAAGTTTCTTCATAACTGGGTAATGCAATACCTGAAA
GGCGATTTAGGTACAGATATTACTCAAAAACAGTTGCAACAAATTAATCAGCACCTCAGCCAATTATTAG
ATAACCAGGTTGTGACATCACCGTTTATTCGTGACAATAATCTGATTAAACAAAAACAGGCGTTAATCAG
CAAAATTCCACCCGCCAAACGCGCCTATCACTATTTAAAAAATAAATTACTGAATGATCCCGATTTAGCA
CCGGTGAATTTGGATACCCTTGCCGGTCCCCAGGCTGAATTGGTTTTCTCAAATATTAATGGAACCGCCT
TCACCGACAGCATACCGGGCATGTTTACGCCCGCCGGTTATCAAAAAGGGATTAATAAAAACCTCAACAC
GTTTCTTACCACATTATATTCGCAGGACAGTTGGGTACTTGGTCCCTATGTAAGGAAGCTGACCATCAAT
GAAATCAGATCTTTTGTTAAGCAGCTCTATATCAATGATTACATCTCTCAATGGGACCAATTTCTGCTCA
ATATCCGTTTGAATAATATCGACAATCTGGAACAACGAATGCGGACCGCGCGTTTATTGTCATCGTCTGA
TTCACCCTTGCGTACCCTTCTGATTAATACCAGTAAAAATGTCACCCTGAATAATGGCATACTGAATAAA
AATAGTGCGGCGGCCAAACAATTCATTCCCAAACAAATATTGTCAGATAATCAGCAAAACACACCAGAAC
AGGAACTCGAAAAACATTTTGCCCAAATGACTGCATTGGCAAAAACCACAAAGGGAAAAAACAATCAAAA
TATCCCTTTTGATGAGACGTTGAAAAACATAGGTGATTTGTATCAGTACCTCACTGACGTACAGAATGCC
ATCAGAACTGGTATGCCTTTTCCGCCCAATAATATTATCACTCAGCTACAGACAACATCTGAACTTCTGC
CAATGCCGTTCAACAGCATTATTGCTTCGCTGGCGGTCGGAGCCAGCAGCGATACTCAGCTTAGTGATGT
GAAAAATGTGGCTAAACACCTCAGTGCAGAAGTCGGCGTTTTTTGTCATCAGGCGATTGCCAACCGCTAC
CCACTGACACCGAAAGCACGCACTGATATCAAACCTGATGATATGGCAAGAATGTTCACCCCGGAAACCG
GTTTAATGGACATGTTTTTCCAGAAGAACTTAGCGAAGAACGTCGATACCACTACGCAAAAATGGCAGTT
CATGCCCGGCATTGATGGTCAGCCAATCCTTGAAGGAGAGACATTGCTCAAGCCCTTCCAACAAGCACTA
ATTATCAGCCATGCTTTATTTTCCGGCGGAACACCCACACCGTCATTCCATGTCATGGTTTACCCAATCA
GCATGGATAACAACATATTAAACATGATACTGGATATAGACGGGCAGAAATTGCAATACAGTCACGGGCC
AAAACGTTCACAGCTCATCAGTTGGCCAGGCTCGGGCAAAACCAATCAGGTTAACATCCAGCTAAATTTA
AGCGATGGCACAACCGCCAGTTTATCAACTTCAGGTTTCTGGGCACTCAACCGACTGCTGGATCACGCAC
AACAGCTCTACCACAATGGCGACACCGATGATTCTGCTTATGCTGATGAGACAGGCCTGAAAGCAATTTT
CAATATCAGGGGCCACACCGTCTCTTTAGGTTTTACGCCCAGTAGTGTTTTCAGCCCCTTTAACCTCCCT
TCTTTCTCGTGCCCGAGTGAGAAGATCTTGACCCTATAA
 Primer design