SecReT6
Protein ID: 300725292
SecReT6 ID399
T6SS typei1
Gene symbol-
Locus tagXNC1_4539
StrainXenorhabdus nematophila ATCC 19061
Repliconchromosome [GenBank: NC_014228] [Browse all T6SS(s) in this replicon]
Location [Strand]4338297..4341902 [-]
Producthypothetical protein
NoteTssM
UniProt IDD3VFA4
KEGG IDxne:XNC1_4539
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.60E-79, Aligned region: 519..845
IcmF-related [PF06761], Evalue: 5.60E-79, Aligned region: 853..938
ImcF-related_N [PF14331], Evalue: 3.80E-71, Aligned region: 211..471
ImcF-related_N [PF14331], Evalue: 3.80E-71, Aligned region: 923..959
DUF1215 [PF06744], Evalue: 2.80E-37, Aligned region: 318..333
DUF1215 [PF06744], Evalue: 2.80E-37, Aligned region: 727..769
DUF1215 [PF06744], Evalue: 2.80E-37, Aligned region: 940..1059
Miro [PF08477], Evalue: 0.001, Aligned region: 144..286
Protein Sequence: 1201 a.a.     [Download]
>gi|300725292|ref|YP_003714623.1| unnamed protein product [Xenorhabdus nematophila ATCC 19061]
MKWPSLSSLAPLKSALPALGKFKSLPRFKATMAVVLALIPCLLLIAVWWWGQEWKIRNDYPLESLAARWL
ATAIIIMVVLVWIGMKAWHRLRTLEKLNLDVELKVVDPVRVDIEHQDRYLEHWKSQLQRHLDSYNYLYER
PWYMVVGSQKSGKTSLIKEGYKLSEIAAPEYLRQDDNIPLMLHCWLGEKAVIIDPKGQLIDQPVPLNSDK
PQINSRLWEAMLNWLAENRQRQPLNGIILTVDTLRLLTDNREQRERYVRELHQRLQDIRLTFHSQLPLYL
VMTKIDLLHGFEAMYQSLDRKLRDQILGVTFSLNNRDEKAWRSELEQFWQQWMNNLNNAMPDMMLNNVDA
NQRSALFSFTRQIQGLYSYVVQMLEDILYNDEHHRPTLRGVYLTSAHQVGQMDDLFTQSASAQYHLGSQA
FPTWPAGDTLPYFTHSLFEDVLLAEPNLAAENRIWLSRNRRQLYTFSTLSALVIMAMWGGWHYFYQKNYR
AGEEVLAQAKNFLSVPPPKGDDRYGDLQLSQLNPIRDATLAYGNYHENASFLTDMALYQGGSVGPYVATT
YRKLLEQRFLPALMLGLLDDLNQAPASSEEKLEILRVMRMMEDKSQRNSALVAQYMRERWSKAFHGQRNI
QDALLTHLDYALDRTDWKELRDKGDKEAITNFAPFVKPIRQAQDELKALSVKQRVYQNLRIRAQDVLSAP
LNLRDQIGPSFDDVFVASNEKRLVIPQLLTRHGLMDYFVRQKDELTKLTEMDSWVLNIAKNNQDKASEAG
LQNNDQYSTKDQERILNDINDLYLSEYTATWRAAMNNLEVRDFDDLPHAISAIEQVISGEQPIKRALQIL
SDNTNPPLADNALSEKQKEDWLKQHDYRLLNRISHDFAQETEVLVERGDKGSTLQSVYQKLTALHRYLLA
IQNSPVPGKAALQAVQMRLDKNNSDAIFEVQQMAKTLPEPLNRWVGELAEQAWRVVMMEAIRSLEVEWND
SVVKQYKTYLAGRYPFNPNATEEVPLSEFERFFRPDGTLDTFYQQSLKPFVEYNLTTGTDGKALIRPDVM
KQLELANRIRTTFFTPQNGLGAQFAIEPLSLTGNKRRALLNLDGQLVDYSHGRSNVARLIWPNSMRAGTE
SKLTLMPDRSNLAPRSLSFMGPWAQLRLINSGKLTNVQPGFFDVRFSVDGGDMTYRVYVDESDNPFAGGL
FSQFKLPDTLY
 
Nucleotide Sequence: 3606 bp     [Download]
>gi|300721089|ref|NC_014228.1|:c4341902-4338297 Xenorhabdus nematophila ATCC 19061 chromosome, complete genome
ATGAAATGGCCCTCTTTGTCATCTTTGGCACCTTTAAAATCAGCCTTGCCAGCGCTGGGAAAATTTAAAT
CCCTGCCTCGCTTTAAGGCTACGATGGCGGTGGTTCTGGCACTGATTCCCTGCCTGCTCCTGATCGCCGT
CTGGTGGTGGGGTCAGGAATGGAAAATCCGCAACGATTATCCGCTGGAAAGCCTTGCGGCCCGCTGGCTG
GCAACCGCCATCATCATCATGGTGGTGTTGGTCTGGATCGGCATGAAAGCATGGCACCGCTTACGGACAC
TGGAAAAACTCAACCTGGATGTCGAACTGAAAGTCGTTGATCCGGTGAGAGTGGATATTGAACATCAGGA
TCGCTATCTCGAACACTGGAAGTCCCAGTTGCAACGCCATCTGGATTCATACAATTATTTGTATGAACGC
CCGTGGTATATGGTGGTCGGCAGTCAAAAAAGCGGCAAGACTTCGCTGATTAAGGAAGGCTATAAGCTGT
CTGAAATTGCGGCCCCGGAATATTTGCGTCAGGATGATAACATCCCCCTGATGTTGCACTGCTGGTTAGG
GGAAAAAGCGGTCATTATTGACCCGAAAGGCCAGTTGATTGATCAACCGGTTCCGCTTAACAGTGACAAG
CCCCAAATCAATAGCCGCCTGTGGGAAGCCATGCTGAATTGGTTGGCTGAAAACCGCCAGCGCCAGCCAC
TCAACGGTATTATTCTGACCGTGGATACCCTGCGTCTGCTGACTGATAACCGCGAGCAACGTGAACGCTA
TGTGCGGGAACTTCACCAGCGTCTGCAAGACATTCGCCTGACTTTCCACAGCCAGTTGCCGCTTTATCTG
GTGATGACCAAAATCGACCTGTTGCACGGTTTTGAAGCCATGTACCAGTCACTGGATCGCAAATTGCGTG
ACCAGATCCTCGGGGTCACATTCAGCCTCAACAACCGGGATGAAAAAGCGTGGCGCAGTGAGCTGGAGCA
GTTCTGGCAACAGTGGATGAACAACTTGAACAACGCGATGCCGGACATGATGCTGAACAACGTGGATGCC
AACCAGCGCAGCGCCCTGTTCAGTTTCACCCGTCAGATTCAGGGGTTGTACAGCTATGTTGTCCAGATGC
TGGAAGATATTCTGTATAACGACGAACATCACCGCCCGACCCTGCGCGGAGTGTACCTGACTTCCGCACA
TCAGGTCGGGCAGATGGATGACTTGTTCACCCAATCCGCTTCGGCTCAGTACCATCTGGGTTCACAGGCG
TTCCCGACATGGCCGGCGGGCGATACCCTGCCGTACTTTACCCATTCCCTGTTTGAAGACGTGCTGCTGG
CCGAGCCGAATCTGGCGGCGGAAAACCGTATCTGGCTGAGCCGCAACCGCCGTCAGTTATATACCTTCTC
CACCCTCAGTGCCCTGGTCATTATGGCGATGTGGGGGGGCTGGCATTACTTCTACCAGAAAAACTACCGG
GCGGGTGAAGAAGTGCTGGCGCAGGCGAAAAACTTCCTGTCCGTGCCGCCGCCGAAAGGGGATGACCGTT
ATGGCGATCTCCAGTTGTCACAACTGAACCCGATCCGTGACGCAACGCTGGCCTATGGTAATTATCATGA
AAATGCTTCTTTCCTGACGGACATGGCGCTGTATCAGGGTGGCAGTGTCGGGCCTTATGTGGCAACTACC
TATCGGAAATTGCTGGAACAGCGTTTCCTGCCCGCCCTGATGCTGGGTCTGCTGGATGATCTGAATCAGG
CCCCCGCGAGCAGTGAGGAAAAACTCGAGATCCTGCGAGTGATGCGCATGATGGAAGATAAAAGTCAGCG
TAACAGCGCTTTGGTCGCCCAGTATATGCGTGAGCGCTGGAGTAAGGCCTTCCACGGCCAGCGCAATATA
CAGGATGCGTTGCTGACCCATCTGGATTACGCCCTTGATCGAACCGACTGGAAAGAGTTGCGTGACAAAG
GCGATAAAGAGGCCATAACCAACTTCGCCCCGTTTGTCAAACCGATCCGGCAGGCGCAGGATGAGCTGAA
AGCGCTCTCGGTCAAGCAGCGGGTTTACCAGAACCTGCGTATCCGGGCACAGGATGTCCTGTCGGCACCG
CTTAACCTGCGTGACCAGATTGGCCCGAGCTTTGATGATGTGTTTGTCGCCAGCAATGAAAAACGGCTGG
TGATCCCGCAGTTACTGACCCGCCACGGGCTGATGGATTACTTCGTCCGGCAAAAAGATGAACTGACGAA
ACTGACCGAGATGGACAGCTGGGTGCTGAACATAGCGAAGAATAATCAGGACAAAGCCAGCGAGGCGGGT
TTGCAGAATAACGACCAGTACAGCACCAAAGATCAGGAGCGGATACTGAACGATATCAATGACCTGTATT
TGTCCGAGTATACCGCCACCTGGCGGGCGGCGATGAACAACCTCGAAGTGCGGGATTTTGATGATTTGCC
CCACGCCATCAGTGCCATTGAACAGGTGATCAGTGGCGAGCAACCCATCAAGCGGGCGCTGCAAATCCTG
AGTGATAACACCAACCCGCCGCTGGCGGACAACGCGCTGAGCGAAAAACAGAAAGAAGATTGGCTGAAAC
AACACGATTACCGCCTGTTAAACCGTATCAGCCACGACTTCGCGCAGGAAACGGAAGTGCTGGTGGAACG
CGGCGACAAGGGCAGTACGCTGCAAAGCGTCTACCAGAAACTGACCGCCTTGCACCGTTACCTGCTGGCG
ATCCAGAACTCGCCTGTCCCGGGCAAAGCCGCCCTGCAAGCGGTGCAGATGCGTCTGGACAAAAACAACA
GTGACGCGATTTTTGAAGTACAGCAGATGGCGAAAACCTTGCCGGAGCCGCTGAACCGCTGGGTCGGCGA
ACTGGCGGAACAGGCCTGGCGGGTGGTGATGATGGAGGCGATCCGTTCACTGGAAGTGGAATGGAACGAC
TCTGTGGTGAAACAGTACAAGACTTATCTGGCGGGACGTTATCCGTTCAACCCCAACGCGACCGAAGAAG
TGCCGCTGAGCGAGTTTGAACGCTTCTTCCGGCCAGACGGCACGCTGGATACCTTCTACCAGCAGAGCCT
GAAACCGTTTGTGGAGTACAACCTGACCACGGGGACGGACGGCAAGGCGCTGATCCGGCCGGACGTGATG
AAACAGCTGGAACTGGCGAACCGCATTCGCACCACCTTCTTTACCCCCCAAAACGGGCTGGGGGCTCAGT
TTGCCATCGAACCGCTCAGCCTGACCGGCAACAAGCGCCGGGCCTTGCTGAACCTGGATGGCCAGCTGGT
GGATTACTCCCACGGCCGCAGTAACGTGGCCCGTCTTATCTGGCCTAACTCCATGCGAGCCGGAACCGAG
AGCAAGCTGACCCTGATGCCGGATCGCAGCAATCTGGCGCCGCGCTCCCTCAGTTTCATGGGCCCGTGGG
CTCAGTTGCGGCTGATCAACAGTGGCAAGCTGACCAACGTCCAGCCGGGCTTCTTTGACGTGCGCTTTAG
TGTGGATGGCGGCGACATGACCTACCGTGTCTACGTGGACGAATCAGACAACCCCTTTGCTGGCGGGCTG
TTCAGCCAGTTCAAACTACCGGATACCCTCTATTAA
 Primer design