SecReT6
Protein ID: 302037300
SecReT6 ID407
T6SS typei4a
Gene symbol-
Locus tagNIDE1973
StrainCandidatus Nitrospira defluvii
Repliconchromosome [GenBank: NC_014355] [Browse all T6SS(s) in this replicon]
Location [Strand]1882727..1886356 [+]
Producthypothetical protein
NoteTssM
UniProt IDD8PEN8
KEGG IDnde:NIDE1973
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.70E-80, Aligned region: 68..134
ImcF-related_N [PF14331], Evalue: 3.70E-80, Aligned region: 196..455
IcmF-related [PF06761], Evalue: 5.70E-51, Aligned region: 73..105
IcmF-related [PF06761], Evalue: 5.70E-51, Aligned region: 504..809
DUF1215 [PF06744], Evalue: 1.10E-25, Aligned region: 935..1057
Protein Sequence: 1209 a.a.     [Download]
>gi|302037300|ref|YP_003797622.1| hypothetical protein NIDE1973 [Candidatus Nitrospira defluvii]
MIGIFSKIRSIVVAILRHPRLVIEFGVVCLIWLVWLIGPQIGLESVESRVQVIIVIGLLRFVFYIVHHLV
SQRRATQLEASLQQQAQLQVAAARADHKEELEALRRQFDKGVAALKESTIGKGLKGKAALYALPWYMFIG
PPASGKSTALRHSGLQFPYLGESGQGLQGMGGTRNCDWWFTNDAVLLDTAGRYVTHEEDQKEWLGFLDLL
KRCRKEKPINGILAAISIADLMQASEEELEAHAKKIRSRVDELMTHLGITFPVYLIFTKCDLVRGFVEFF
EELTKTEREKIWGCTFSKSSAKEPAHVRFKAEFDQLLAAVKSRRLARLVNARGPYKLNIFTFPLQLASAT
DKLNHFVDVLFQSNPYQENPMFRGFYLTSGTQEGAPIDRILGAISRASGLGEMVASMFSPAETKSYFLKD
LFTEVIFPDHFLAGPTTTIHKQRGFLRVASFAAATVFIAISVVALAWSYVGNKALVSSTLSAALNAPDVA
LTDAASLERNTEYLDKLGDRFDELLSYTQNGAPLRLWGFYRGERLLDDLQEVYARQFEKIFLIPTKRYME
DELYRFTAGDVPRTTAHSSDYYYAMLKAYIMLGEPKRVSTAYLERWLTAHWSEQLSRLYATYAVPDWVQS
SIKRHMILYARYLARVQQGRVELNKHLVASVQEQLRDIPIVERLYGLSLREIDESLRPFSVETALQGSHQ
GSVVSDYIVPGVFTLEGWKGPFQSAMTRVLEGLGNEAWVIGEPDTKQVDLERGIKKLYFQDYVLHWRAFL
KSLKLGPAVTPANMEELLSTLSQTDSPVMRILEAVDHNTVPEPEGIAKLQDTAAGLLGKVKEKLGLESVG
KKFEKTKRDPDTAEFPGGVTIHFLAMHNLIAAQKDAKEEAPFIQYLAELRKAHQVFRPLLRSETVGPDTK
TLAKSIVAGEPNDLLQGVIKTDALLQKLDTELRESMLAVLSEPWLMTMRGVLERTRSDIDRRWGADVFQA
CQRTIEGKFPFRASGEDAVVADVVDFFHPSNGTLWRFYQAELKAFMEESGERLVRKAWNGIGMTFSDAFL
ESMERARFISDGLFTKGSPDLGTVLEVYPYPPQGFAGRTVTEVRLDVGGQPLRYRMEPQEWWEMKWPGPT
PSAGATLLVQVGNTWVTREYKDVWGLFKLMNAGSVETADHSEVMVKVRWELQSPDAKPLQVRYDVKGRSA
RNPFRSGFFEQFNCAQHLM
 
Nucleotide Sequence: 3630 bp     [Download]
>ref|NC_014355.1|:1882727-1886356 hypothetical protein NIDE1973 [Candidatus Nitrospira defluvii]
GTGATCGGAATCTTTTCGAAGATAAGGTCGATCGTGGTGGCCATACTCCGGCATCCGCGTTTGGTGATCG
AGTTCGGAGTGGTCTGTCTGATTTGGCTGGTGTGGTTGATCGGGCCCCAGATAGGTCTGGAATCAGTCGA
AAGCCGAGTACAGGTGATCATCGTCATCGGCCTGCTTCGGTTCGTGTTCTATATCGTTCACCATCTCGTC
TCGCAGCGCCGTGCCACCCAATTGGAGGCATCGCTTCAACAGCAAGCGCAACTACAGGTGGCGGCGGCCA
GAGCAGATCATAAGGAGGAGCTGGAAGCGCTGCGTCGCCAGTTCGATAAGGGCGTGGCGGCGTTGAAAGA
GTCCACCATCGGAAAGGGGCTTAAGGGGAAAGCGGCTCTCTATGCGTTGCCCTGGTATATGTTCATCGGC
CCGCCTGCGTCGGGAAAGAGCACGGCCCTGCGGCATTCCGGGTTGCAGTTTCCCTATCTCGGCGAATCCG
GACAGGGACTTCAGGGCATGGGAGGCACGAGAAACTGCGATTGGTGGTTTACCAATGACGCCGTCCTGCT
GGACACGGCCGGTCGCTATGTCACGCATGAGGAAGATCAGAAAGAATGGCTGGGCTTTCTCGATCTGTTG
AAGCGATGTCGGAAGGAGAAACCCATCAACGGAATCCTTGCGGCGATCAGTATCGCTGATCTGATGCAGG
CCAGCGAAGAAGAGTTAGAGGCTCATGCCAAGAAAATTCGCAGCCGGGTTGATGAATTGATGACACATCT
CGGGATCACCTTTCCCGTCTATCTCATTTTTACCAAGTGTGACTTGGTGAGGGGCTTTGTTGAATTTTTT
GAGGAGCTGACCAAGACCGAACGGGAGAAAATCTGGGGCTGTACCTTCTCCAAGAGTTCCGCCAAGGAAC
CGGCGCATGTGCGCTTTAAGGCCGAGTTTGATCAGTTGCTCGCCGCCGTGAAATCCAGGCGGCTCGCGCG
CCTCGTGAACGCGCGGGGACCGTACAAGCTCAATATTTTCACGTTTCCTCTCCAGCTCGCCTCTGCGACC
GACAAGTTGAACCATTTTGTGGACGTGTTGTTTCAATCAAATCCCTATCAGGAAAATCCGATGTTCCGGG
GATTCTATTTGACGAGCGGGACACAGGAGGGCGCACCGATTGATCGGATCCTGGGGGCCATCAGCAGGGC
TTCCGGACTCGGAGAGATGGTCGCCTCAATGTTCTCGCCGGCAGAGACAAAGAGCTATTTCCTGAAGGAC
CTCTTTACCGAAGTGATCTTTCCCGATCACTTTCTGGCCGGGCCTACGACTACCATACACAAGCAACGGG
GGTTCCTGCGTGTTGCCTCCTTTGCCGCGGCGACGGTGTTTATCGCAATCTCCGTCGTCGCACTCGCATG
GTCGTATGTCGGAAACAAGGCGCTGGTCAGCAGTACCTTGTCCGCAGCGTTGAATGCCCCCGACGTCGCA
TTGACAGATGCGGCAAGTCTTGAAAGGAACACGGAGTACCTTGATAAGCTGGGCGATCGTTTCGACGAGC
TTCTTTCCTATACCCAGAACGGCGCACCTCTGCGTTTATGGGGTTTTTATCGTGGCGAGCGTCTTCTTGA
CGATCTTCAGGAGGTCTATGCGAGACAGTTCGAGAAGATCTTCCTCATTCCCACCAAGCGCTATATGGAA
GACGAGTTATATCGGTTTACGGCAGGAGACGTCCCCAGAACGACAGCGCATTCGAGTGATTATTACTACG
CCATGCTCAAGGCGTACATCATGCTGGGTGAGCCCAAACGTGTGAGCACCGCATACCTGGAGCGGTGGCT
GACGGCGCACTGGAGCGAGCAGCTGAGCCGTCTGTATGCGACCTATGCTGTTCCGGACTGGGTGCAATCA
AGTATCAAGCGGCACATGATCCTCTATGCCAGGTATCTGGCCCGAGTGCAGCAGGGACGGGTCGAATTAA
ATAAGCACCTCGTGGCAAGTGTGCAGGAACAGTTGCGCGATATTCCCATCGTGGAACGTCTCTACGGCCT
CAGTCTTCGTGAAATCGACGAATCGTTGCGCCCCTTCTCGGTGGAAACCGCACTTCAGGGCAGTCATCAA
GGTAGTGTGGTCAGCGACTATATTGTCCCGGGGGTGTTCACCTTAGAGGGGTGGAAGGGGCCGTTTCAGA
GTGCAATGACGCGGGTGCTCGAAGGTCTAGGAAATGAAGCCTGGGTCATTGGTGAGCCTGATACGAAACA
AGTCGATCTCGAGCGGGGGATCAAGAAGCTGTATTTTCAGGATTATGTGCTTCATTGGCGGGCATTCCTC
AAGTCACTGAAACTCGGGCCGGCCGTCACTCCGGCGAATATGGAAGAATTGCTCTCAACGCTGAGCCAGA
CAGATTCACCTGTTATGAGAATATTGGAAGCGGTCGACCACAACACCGTGCCTGAGCCGGAAGGCATCGC
AAAACTCCAGGACACCGCTGCCGGCCTGTTGGGAAAGGTCAAAGAGAAGTTAGGGTTGGAATCCGTCGGC
AAGAAATTTGAGAAGACAAAAAGAGACCCGGATACCGCTGAGTTTCCCGGCGGGGTGACCATACACTTCC
TCGCCATGCATAACCTGATCGCGGCCCAGAAGGATGCGAAAGAGGAGGCTCCCTTTATCCAATATCTGGC
AGAGTTACGAAAGGCGCATCAGGTGTTTCGACCACTTCTCCGTTCGGAGACCGTCGGGCCGGACACGAAA
ACCCTTGCGAAGAGCATTGTGGCGGGAGAGCCCAACGACCTTCTGCAAGGAGTCATTAAAACGGACGCGT
TGCTGCAGAAGCTGGATACTGAATTGCGTGAATCGATGTTGGCAGTGCTGTCCGAGCCATGGTTGATGAC
CATGCGAGGTGTGCTGGAGCGAACTCGATCGGATATCGATCGACGCTGGGGCGCCGACGTATTTCAGGCC
TGTCAACGGACGATTGAAGGGAAGTTCCCATTTCGCGCGTCAGGCGAGGATGCGGTCGTAGCCGACGTCG
TGGACTTCTTTCACCCCTCCAATGGCACCCTGTGGCGTTTTTACCAGGCAGAGCTCAAGGCGTTTATGGA
GGAGAGCGGTGAACGGCTGGTTCGCAAGGCTTGGAACGGAATCGGGATGACCTTTTCGGATGCGTTCTTA
GAGTCGATGGAGCGGGCCAGATTTATTTCAGATGGACTTTTTACAAAAGGCTCTCCCGATCTGGGAACAG
TCCTAGAGGTCTATCCATACCCGCCACAGGGATTTGCCGGTCGAACGGTCACCGAGGTGCGACTGGATGT
GGGCGGTCAACCGCTGCGTTATCGCATGGAACCACAAGAATGGTGGGAGATGAAATGGCCTGGGCCCACA
CCCTCAGCCGGAGCCACGCTGCTTGTCCAGGTGGGCAACACCTGGGTCACGAGGGAGTACAAAGATGTCT
GGGGACTCTTCAAACTTATGAATGCCGGGTCGGTTGAGACGGCCGATCATAGTGAGGTCATGGTCAAGGT
CCGATGGGAACTGCAGTCCCCGGATGCAAAGCCGTTACAGGTTCGGTATGACGTGAAGGGCCGGAGCGCC
AGGAATCCATTCCGTTCCGGATTTTTTGAGCAGTTCAACTGCGCGCAGCACCTCATGTGA
 Primer design