SecReT6
Protein ID: 304310849
SecReT6 ID408
T6SS typei1
Gene symbol-
Locus tagHDN1F_12110
StrainGamma proteobacterium HdN1
Repliconchromosome [GenBank: NC_014366] [Browse all T6SS(s) in this replicon]
Location [Strand]1498750..1502310 [-]
Producthypothetical protein
NoteTssM
UniProt IDE1VJ02
KEGG IDgpb:HDN1F_12110
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-38, Aligned region: 181..442
ImcF-related_N [PF14331], Evalue: 4.30E-38, Aligned region: 855..889
DUF1215 [PF06744], Evalue: 0.00013, Aligned region: 508..544
DUF1215 [PF06744], Evalue: 0.00013, Aligned region: 982..1034
Protein Sequence: 1186 a.a.     [Download]
>gi|304310849|ref|YP_003810447.1| unnamed protein product [gamma proteobacterium HdN1]
MKTFFKILLAVLIWTLIAAVLVGGALFFDIAIESAVTVLITLMALWYGFKILRWGYRRHQARQRVEQLIN
VAPDERGIRTSVWRLWGRRNEKDERFLEILRFLHSSSLRRHGDTRYVQPWHLLLGESSANKTEMLQGLHI
PRPTLDSPLLHGDGQDVTWYLHNRGIILDTPNPWSDPTTEGSNEDWLRLLMQLEKHRQHIPINGLLIAVS
VQTLLSAGTDTLERIANKYRRLIEDVVQVLGVNVPIHLILTQTEALPGFDAWVSALPAQQTREALGATRE
TTSRHHSNGAPEAPAKFAGNLVKRIAHRIREINLLALRDQHATADTLRLPLRLQALERPLSWFTASLFES
NQYQETPQLRSIHFSAQAVVPDEILTADPILTTRDPAPAAATNNDRQTLFLWPLFTQLLPAQRDEFTFVH
AANEAKRRRQRQRAIGWSAAVAILTTGITGLYLHDRASLRDASNVYARQLLPPADLDSRVANLIAYKTLI
ERVEAQRFFPWLAPGVEPAFVAKMKEDLANRVNTTLIQEIDSLFEARLQQTFFADSSQDLGRVAEYTGLL
VRRINLLNAWAEGASPTALANLPPAFDTESFAARDADSLAPINTLYLQALQWARESHPDTYQSTASTQRA
TLQQRLDKILIHAGNDFTWLITWANRNPNLKSYRISQFWKSGSGSLPNDISVPRAYTAAGKNRIDGFIDE
LRQAGVNPQRLDEALPHFQTHYRAQYLKAWEQFAFNFSDGIQSLRTREEWLDVINQLNTGRNPYFNALNL
LDTELAPYRDDADIPDWVALSNYYQDMRALGPSDGTSNTKRNRILTNLVLKTIGKAGPLGQMLSKSGKST
LKTKNKLDKASGGPSADERAAQLEQAAEQLKAYQDALGEFVYSAEVRSSAYTATTALFNEPDNPAAGGSP
YAKAYASIQKLQAIAGKETNANAAFWRLYKAPLNLLRGYMLQEASCQLDDSWRNNVLAELEGVPDFKRDD
YLRGETGILWSFLSGPAQAFARQELGRGYTLKRAQGSTLTITPAFLDFATRAKAVRKNTGIVNVEINAYP
ASLNLDAHTAISKSTLTVICPEGSYELHNYNYPASRSFPWTTACTSVSLDIRLNSLNLNKTWTGATAFPD
FIHAFGGGPKGFTPRDFPGQAQQLRELGVDEILLQFDISGASQVLQSVAISPLNIPQHISSCWAML
 
Nucleotide Sequence: 3561 bp     [Download]
>gi|304309652|ref|NC_014366.1|:c1502310-1498750 Gamma proteobacterium HdN1 chromosome, complete genome
GTGAAAACCTTTTTCAAAATACTCCTTGCTGTACTGATCTGGACACTCATCGCCGCCGTTTTGGTTGGCG
GCGCGCTATTCTTCGACATTGCGATTGAATCCGCAGTCACCGTTCTCATCACGCTCATGGCGCTTTGGTA
TGGATTCAAAATACTACGCTGGGGCTATCGGCGTCACCAAGCACGCCAGCGCGTTGAACAACTGATTAAC
GTCGCACCGGATGAACGCGGCATCCGTACCAGCGTCTGGAGACTCTGGGGGCGGCGCAACGAGAAAGACG
AACGTTTCCTAGAAATTCTGCGTTTTCTCCACTCCAGCAGCCTACGCCGACACGGCGACACCCGTTATGT
ACAACCATGGCACCTCCTTTTGGGTGAAAGCAGCGCCAACAAAACCGAAATGCTACAAGGGCTGCACATC
CCCCGCCCCACCTTGGATAGCCCACTGCTGCATGGCGATGGCCAAGACGTAACGTGGTACCTGCACAACC
GAGGCATTATCCTTGACACCCCGAATCCGTGGTCAGACCCCACCACAGAAGGCTCCAACGAGGATTGGCT
GCGCCTCCTGATGCAACTCGAAAAACACCGCCAGCACATTCCCATCAACGGCCTGCTGATCGCGGTGTCG
GTACAGACTCTGTTAAGCGCGGGTACCGACACTCTTGAGCGCATAGCCAACAAATATCGCCGTCTCATTG
AAGACGTCGTACAAGTGCTGGGCGTCAATGTACCGATCCACCTAATCCTGACGCAAACCGAAGCGCTCCC
CGGCTTCGACGCGTGGGTGTCTGCTCTACCGGCCCAACAAACCCGCGAAGCACTCGGCGCAACACGAGAA
ACCACGTCTCGCCATCACAGCAACGGAGCCCCTGAAGCGCCCGCAAAATTCGCAGGCAACTTAGTCAAAC
GCATCGCGCATCGCATACGCGAAATCAATCTACTTGCACTGCGTGATCAGCACGCCACAGCAGACACCTT
ACGCCTACCGTTACGCCTGCAGGCGCTAGAACGCCCGCTCTCGTGGTTCACCGCCAGCCTGTTCGAAAGC
AATCAATACCAAGAAACTCCACAGCTCCGCAGCATCCATTTCAGCGCTCAAGCCGTCGTACCCGATGAAA
TCCTCACCGCCGACCCGATCTTGACTACCCGCGATCCCGCCCCCGCAGCGGCAACCAACAACGACCGCCA
AACTCTGTTCCTCTGGCCACTGTTTACTCAGCTACTACCCGCCCAGCGTGACGAATTCACCTTTGTCCAC
GCAGCAAACGAAGCCAAGCGGCGGCGCCAACGCCAGCGCGCAATCGGCTGGTCGGCCGCCGTTGCCATTC
TTACCACCGGCATCACCGGGCTCTACCTGCACGATCGCGCCTCATTGCGCGATGCCAGCAATGTGTACGC
TCGTCAGCTCCTTCCACCTGCAGATCTGGATTCCCGCGTTGCCAACCTCATTGCATACAAGACGCTGATC
GAACGCGTGGAAGCCCAGCGTTTTTTTCCCTGGCTGGCTCCGGGAGTTGAGCCAGCATTTGTTGCAAAAA
TGAAGGAAGACTTGGCAAACCGCGTCAATACGACCCTGATTCAGGAAATCGACAGCCTCTTTGAAGCCCG
CCTCCAGCAAACCTTCTTCGCCGATTCCAGCCAAGATTTAGGACGCGTCGCCGAATACACCGGGCTGCTA
GTACGCCGCATCAACCTTCTCAACGCGTGGGCAGAAGGCGCAAGCCCAACAGCACTCGCCAATCTGCCCC
CCGCCTTTGACACCGAAAGCTTTGCAGCGCGCGATGCCGACAGCCTCGCCCCGATCAACACCCTCTACCT
CCAAGCCCTGCAATGGGCTCGTGAGAGCCACCCCGATACCTATCAAAGTACTGCCAGCACCCAGCGCGCC
ACGCTGCAACAGCGCCTTGATAAAATCCTGATCCACGCCGGAAACGATTTCACTTGGCTAATCACATGGG
CCAACCGTAACCCGAATCTTAAATCCTACCGAATCTCCCAATTCTGGAAATCCGGCAGCGGAAGCCTTCC
AAACGACATCAGCGTCCCACGCGCCTATACCGCAGCCGGCAAAAACCGCATCGACGGCTTTATCGACGAA
CTCCGCCAAGCAGGAGTGAACCCCCAACGCCTAGACGAAGCCCTCCCGCATTTCCAGACCCACTACCGCG
CCCAGTACCTAAAAGCCTGGGAGCAATTCGCGTTCAATTTTAGCGACGGCATCCAATCCCTGCGCACCCG
CGAAGAATGGCTCGACGTCATCAACCAGCTCAACACCGGCCGCAACCCCTATTTCAACGCCCTCAACTTG
CTAGATACCGAACTCGCTCCCTACCGCGACGACGCCGACATCCCCGACTGGGTCGCCTTGAGCAACTACT
ACCAAGACATGCGCGCCCTCGGCCCCTCCGACGGCACCAGCAACACCAAGCGCAATCGAATTCTCACCAA
CCTTGTGCTCAAAACCATCGGCAAAGCAGGCCCCTTAGGGCAAATGCTCTCCAAATCCGGTAAATCGACG
CTAAAAACCAAAAACAAACTCGACAAAGCCTCTGGCGGCCCCTCCGCCGATGAACGCGCAGCGCAACTCG
AACAGGCCGCAGAACAACTCAAAGCCTACCAAGACGCGCTCGGTGAATTTGTCTACAGCGCCGAAGTCCG
TTCCAGCGCCTACACCGCCACCACCGCTCTATTCAACGAACCGGATAATCCAGCCGCCGGCGGCAGCCCC
TACGCCAAAGCCTATGCCAGCATCCAGAAACTACAGGCCATTGCCGGCAAAGAAACCAACGCAAACGCCG
CCTTCTGGCGCCTCTACAAAGCCCCACTCAACCTACTGCGCGGCTACATGCTGCAAGAAGCCTCTTGCCA
ACTCGACGATAGCTGGCGCAACAACGTCCTCGCCGAACTCGAAGGCGTTCCTGATTTCAAGCGTGACGAC
TACCTGCGCGGCGAAACCGGCATCTTGTGGAGCTTCCTAAGCGGCCCCGCCCAAGCATTCGCCCGCCAAG
AATTAGGCCGTGGCTATACACTGAAGCGTGCCCAAGGCTCCACCCTCACGATCACCCCCGCATTTCTCGA
CTTCGCCACCCGCGCGAAAGCCGTTCGTAAAAATACCGGCATCGTAAACGTAGAAATCAACGCCTATCCC
GCCAGCCTCAACCTCGACGCCCACACCGCCATCAGCAAATCCACACTCACCGTCATCTGCCCCGAAGGCA
GCTACGAACTGCACAACTACAACTATCCCGCCTCTCGCAGCTTCCCGTGGACCACCGCGTGCACCAGCGT
CAGCCTCGATATCCGCCTGAACTCACTGAACCTTAATAAAACCTGGACCGGCGCGACCGCATTCCCCGAC
TTTATCCATGCCTTCGGCGGCGGCCCCAAAGGCTTCACGCCCCGCGATTTTCCCGGCCAAGCACAGCAAT
TACGAGAACTCGGCGTGGATGAAATCCTGCTGCAATTCGACATCAGCGGCGCATCACAAGTGCTACAAAG
CGTAGCGATCTCCCCGCTGAACATCCCGCAACACATCAGCTCCTGCTGGGCAATGCTCTAA
 Primer design