SecReT6
Protein ID: 307130231
SecReT6 ID409
T6SS typei1
Gene symbol-
Locus tagDda3937_00804
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1589582..1593079 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDE0SGP1
KEGG IDddd:Dda3937_00804
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.40E-91, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 8.40E-70, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 3.10E-32, Aligned region: 757..780
DUF1215 [PF06744], Evalue: 3.10E-32, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|307130231|ref|YP_003882247.1| unnamed protein product [Dickeya dadantii 3937]
MLKIIITFLRQQLPKLKPSWLLLGVVVWVVALVLAWWLGPRLTLGDIRPLQSVWGRVVFTLVWLWLGFAY
SAWRVWRRVQQLRAERREQQIIEQDPLQVYVDSQQTFLDRWLQAFQTQLGKKALYAMPWYLAIGLSGSGK
SSLIHRANPANKLNPKLDAELREVAGGQQVNSWVGESAVIWDPSGQLLAQPEVGAEPSAGRHARLWQHLL
QWLSLNRRRQPLNGLVLTIDLSWLSQASVSERKAYAQVMRARLQEIAVNINTRLPLYVALTRLDMLRGFD
VVYRSLNREARQAVLGVTFTPQASHGKGWLEELERFWDDWIANLNNNLPEMLLTQSDRGVRNTLFTFVRQ
LAGLKDYVTEVLNETLATGDDRAFLVRGVYVSSVYQQGVPFDAFSQSASRRYQLPEPINAAMRGESNTFF
VQKLFPEVIFPEASLAGENRLHSLYRRRRMSIGITCMVLFGLAMIGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQAGYGYQQLPRLNLIRDATLSFGNYHERTPMLADLGLYQGDKIGPYVEGSYLQMLNQRFLPAV
MQGLLEDLNQAPAGSEQKLTILRVMRMLDDASGRNKTLVEQFMALRWQKAFPGQGRVQEQLMQHLDYALD
HTDWHQSREQKDTVAISTFAPFVDPIAGAQRELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDS
VFTLRNDKAGTVPRLLTYPGFSDFYLKQDKTLLDLTALDAWVLGQRERAHLSEADRKEILRQVNDRYITD
YINQWQKALANIDVQPLESPEQALNILTDITGNDQPFQRVLTTVSDNTRIRKLADDENDTAQGINTRIGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYPFNPSSDKDVPLSEMERFFAT
GGTLDSFYQTNLKSIMDSGMLEGEGASPLQTELVKQLDRATRIRQTLFNAQGSLEIHFVVEPVELTANKR
RSVLNLDGQLLEYSHGRRTKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFTGPWAMFRLLTNGQLTQ
VNDNTFDVRFSLEQGGMTYRVYTDASHNPFAGGLFSQFKLPDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1589582-1593079 Dickeya dadantii 3937 chromosome, complete genome
ATGTTGAAAATAATCATTACCTTTCTGCGGCAACAGCTGCCGAAACTGAAACCGTCCTGGCTGCTGCTGG
GGGTGGTGGTATGGGTGGTGGCGCTGGTGCTGGCCTGGTGGCTGGGACCGCGGCTGACCCTCGGCGACAT
ACGTCCGCTGCAAAGCGTGTGGGGCCGCGTGGTGTTCACGCTGGTCTGGCTGTGGCTGGGCTTTGCCTAC
AGCGCCTGGCGCGTCTGGCGCCGGGTGCAGCAATTGCGCGCGGAACGGCGTGAACAGCAGATTATCGAGC
AGGACCCGCTGCAGGTGTACGTCGACAGCCAGCAAACCTTTCTGGATCGCTGGTTGCAGGCGTTTCAGAC
CCAACTGGGCAAAAAAGCGCTGTACGCCATGCCCTGGTATCTGGCGATCGGCCTGTCCGGCAGCGGTAAA
AGCAGCCTGATTCATCGCGCTAACCCGGCCAACAAGCTCAACCCGAAGCTGGATGCGGAATTGCGCGAAG
TGGCCGGCGGTCAGCAGGTTAACAGCTGGGTCGGCGAGTCGGCGGTGATCTGGGATCCAAGCGGTCAACT
GTTGGCCCAGCCGGAAGTCGGCGCGGAGCCGTCGGCCGGCCGTCATGCCCGCCTGTGGCAACACCTGTTG
CAGTGGCTGAGCCTCAACCGTCGTCGCCAGCCGCTGAACGGGCTGGTGCTGACTATCGACCTGTCCTGGT
TGTCGCAGGCCAGCGTGTCGGAGCGTAAGGCGTATGCGCAGGTGATGCGCGCCCGTTTGCAGGAAATCGC
CGTCAATATCAATACCCGCCTGCCGCTGTACGTGGCGCTGACCCGTCTGGACATGCTGCGCGGTTTTGAC
GTGGTATACCGCTCGCTGAACCGGGAAGCGCGTCAGGCGGTGCTGGGGGTGACGTTCACGCCGCAGGCCA
GCCACGGCAAAGGCTGGCTGGAGGAGCTGGAGCGCTTTTGGGACGACTGGATCGCCAACCTCAACAATAA
CCTGCCGGAAATGCTGCTCACGCAGTCGGATCGCGGCGTGCGCAATACGCTGTTCACCTTCGTGCGCCAA
CTGGCCGGGTTAAAGGATTACGTGACGGAAGTGCTGAACGAAACGCTGGCGACCGGCGACGACCGCGCAT
TTCTGGTACGCGGCGTGTATGTCAGCTCGGTGTACCAGCAGGGCGTGCCGTTCGACGCCTTCTCCCAGTC
GGCCTCCCGGCGGTATCAGTTGCCGGAGCCGATCAACGCCGCCATGCGCGGCGAGTCGAATACGTTCTTC
GTGCAGAAACTGTTCCCGGAGGTGATTTTCCCGGAAGCCAGTCTGGCGGGGGAAAACCGGCTGCACAGCC
TGTATCGCCGTCGCCGCATGAGCATCGGCATTACCTGCATGGTGCTGTTCGGGCTGGCGATGATCGGCAG
CTGGCACCATTTCTATCGGGTAAACGAAGAGGCCGGCCGTAACGTGCTGACCAAGGCGCAGGCGTTCATC
GGCACCAACGAACTGGAAGGGCAGGCGGGGTACGGTTATCAGCAACTGCCGCGTCTGAACCTGATCCGCG
ACGCCACCCTGTCGTTCGGCAACTACCACGAACGCACGCCGATGCTGGCCGACCTTGGGCTGTATCAGGG
CGATAAGATCGGCCCTTACGTGGAAGGCTCTTACCTGCAAATGCTCAACCAGCGTTTCCTGCCGGCGGTG
ATGCAGGGGCTGCTGGAAGACCTGAATCAGGCGCCGGCCGGCAGCGAGCAGAAACTCACTATTTTGCGGG
TGATGCGGATGCTGGACGACGCCTCCGGACGCAACAAGACGCTGGTGGAGCAGTTCATGGCGCTGCGCTG
GCAGAAGGCGTTTCCGGGGCAGGGCAGGGTGCAGGAACAGCTGATGCAGCATCTGGATTACGCGCTGGAT
CATACTGACTGGCACCAGTCCCGCGAGCAGAAGGATACGGTGGCGATCTCCACCTTCGCGCCGTTCGTCG
ACCCGATCGCCGGCGCCCAGCGCGAGCTGAGCAAGTTGCCGATGTACCAGCGCGTCTACCAGAGTCTGGT
GATGAAGGCGACGCAGGTGCTGCCGCCGGATCTGGCGATTCGCGACGAAGTGGGGCCGACGTTCGATTCG
GTCTTCACCCTGCGCAACGACAAGGCGGGCACGGTGCCGCGGCTGCTGACCTATCCCGGCTTCAGCGATT
TCTACCTCAAGCAGGATAAAACGCTGCTGGACCTGACCGCGCTGGATGCCTGGGTGCTGGGTCAGCGTGA
GCGCGCCCACCTGAGCGAGGCCGACCGCAAAGAGATCCTGCGTCAGGTGAACGACCGCTATATCACCGAC
TACATCAACCAGTGGCAAAAAGCGCTGGCGAATATCGACGTCCAGCCGCTGGAAAGCCCGGAACAGGCGC
TGAACATACTGACCGACATTACCGGCAACGACCAGCCGTTCCAGCGGGTGCTGACCACGGTGAGCGACAA
CACCCGCATCCGCAAGCTGGCGGATGACGAAAACGACACCGCGCAGGGCATCAATACCCGCATCGGTCGC
CCGTTCATGACCATCAACGCCGCGCTGAGCGGGCGGGGCGAGCAGGGGCCGCTGGTGCAGGAGGTCAACC
AGAAGCTGACCGATCTCTACCACTATCTGGATCAGATCGTGAACGCCACCGACCCGGGGCAGGCGGCGCT
GAAAGCGGTGCAGGCGCGTCAGGGCAACAAGTTCGCCGACCCGGTGTTCGCGTTGCAGCAGTATGCCCGC
AGCCTGCCGGCGCCGTTGGATCGTTGGGTCGGCCAACTGGCGGGAGAAAGCGCCAGTCTGGTGACCGGGC
TGGCGATGTCGTCGCTCAATCAGGAGTGGCTGGACAAAGTGGTGACGCCGTTCAACGAGAAACTGGCGGA
CCGTTACCCGTTCAACCCGTCTTCCGACAAGGATGTACCGCTGTCCGAGATGGAACGCTTCTTCGCGACC
GGCGGTACGCTGGACAGCTTCTACCAGACCAACCTCAAGTCGATCATGGACAGCGGGATGCTGGAGGGCG
AAGGCGCGTCGCCGTTGCAGACGGAGCTGGTGAAACAGCTGGATCGCGCCACCCGTATCCGCCAGACGCT
GTTCAATGCGCAAGGCAGCCTGGAAATCCACTTTGTGGTGGAACCGGTGGAACTGACCGCCAACAAGCGC
CGCAGCGTGCTGAATCTTGACGGACAGTTGCTGGAATACAGCCACGGACGCCGGACCAAAACGCCGCTGG
TGTGGCCGAACAGTATGCGTGACGGCGCCGAAAGCAAGCTGACGCTGGTGCCGGATGACCGCGAACGCTC
GCCGCGCAGCCTGAGCTTCACCGGCCCGTGGGCGATGTTCCGCCTGCTGACCAACGGCCAGCTGACGCAG
GTGAACGACAATACCTTCGACGTGCGTTTCTCGCTGGAACAAGGCGGCATGACCTATCGCGTCTATACCG
ACGCCAGCCACAATCCGTTTGCCGGTGGTCTGTTCAGCCAGTTCAAACTGCCTGATTCTCTCTATTAA
 Primer design