SecReT6
Protein ID: 307545500
SecReT6 ID410
T6SS typei1
Gene symbolpmt1
Locus tagHELO_2910
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2230495..2234148 [-]
Producthypothetical protein
NoteTssM
UniProt IDE1V3W5
KEGG IDhel:HELO_2910
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.60E-85, Aligned region: 260..281
IcmF-related [PF06761], Evalue: 7.60E-85, Aligned region: 532..849
ImcF-related_N [PF14331], Evalue: 1.10E-75, Aligned region: 222..483
DUF1215 [PF06744], Evalue: 2.70E-35, Aligned region: 943..1064
Protein Sequence: 1217 a.a.     [Download]
>gi|307545500|ref|YP_003897979.1| pmt1 gene product [Halomonas elongata DSM 2581]
MWRRVKARLSRWVPGMAQADSQLNQARGHANRARGLKRLGIWLWWLLVIALLVAIWWLGPQWQAFGGRPL
GPWVNRLLASLALAGVVAVVWGIRLARRLRTLDDERRQEEQRQVDPVLGQLERQEESLNATLLELTDSLG
GGANARYKLPWYLVMGVENAGKTSLINRSGQNFSLTHVMKASGQGKRGRLGFDWWIGDKAVLIDPDGELL
TQGALQGGQPAELESRLWDHFVDWLERHRSRRPLDGVVLVLDLARLSDAEVAVRKAYASLLRARLRELME
RHGSRLPVYVTFSKMDLLHGFDDFFRHYSRAARRAPLGFTFSAASLERPGRWEEEFAEGYDDMLERLNQT
LPTLLVECRDRDEREAVFRFVRQLAGLRDVLLGFLGEALSSDRFSTAALVRGAYFTSVYQQGVPEDPFVD
AAARRYGMTDGVQAAHRATRSALYFTEELFERIIYPESGLAGDNARAARRRRRIRRASALGCLFVGAALV
GGWYHFYEKNSKALAAVEDKAEAFLAVRPSDWQNDDPTGYALLEPLDRLLSATQEFGDYRSRPWLLADMG
LYQGHELGVEIDNGYLRLLEEQFLPALMIGIMDDMNRAPEGSNEKLALLRILRMMSDASGRQPQRVHDFM
EDRWQEAFPGRGEVQRRLLAHLDYALAYTDLAGHAEAGQSGARQAMAPLDGSIEAAQQELARQPMAERVY
ASLKSGIDEHRAAPLDLRSSVGSSFSLVFMARDDNPELVRIPGLLTRNGFEDYFLDQLDQATELALVDTW
VLGQRDDIDFSEADHRQLQEALRERYISDYHVTWREALADIRMVPLPDIHQAVVVADGLLSASRPLDRLL
GEVADQTRLYPELPADDEAARAALKKSPRYQLASEIERHFAALNELSEERGDNPSKLDEIKSAIGDLRDY
LRQVDEADERGQRAFLLARDRISLKGEDPIARLKRIAEDVPAPVSGMLESLADQSWQLLMASAVRHLEHQ
WVDEVVRPFQQDLAGRYPLAPQASREVALADFEDFFAPDGILDAFYQRNLKPFIEGAPEALRTDGGDSLL
RQGVLDAVQRAERIREAYLNRDGVLDVAFSLEPLSLSADKRRGVISVDGQLIDYAHGPSRRVPMIWPNGL
RESNESRVTLVPSEVNHSPRTLRRDGPWAWFRLLDEAQLTGTGERELELSFEVDGGSMRYRLTADGSRNP
FTRSLVAGFNLPTTLYAAGGPDDADDA
 
Nucleotide Sequence: 3654 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2234148-2230495 Halomonas elongata DSM 2581 chromosome, complete genome
ATGTGGAGACGAGTGAAGGCCAGGCTGAGTCGCTGGGTGCCAGGCATGGCCCAGGCGGACAGCCAGCTCA
ACCAGGCGCGGGGACACGCGAACAGGGCTCGGGGGCTGAAGCGTCTGGGCATCTGGCTGTGGTGGCTGCT
GGTCATCGCCCTGTTGGTGGCGATCTGGTGGCTGGGGCCGCAGTGGCAGGCATTCGGGGGACGGCCGTTG
GGGCCCTGGGTCAACCGCCTGCTGGCCAGCCTGGCGTTGGCCGGGGTGGTGGCGGTGGTGTGGGGCATCC
GCCTGGCGCGACGCCTGCGCACCCTCGATGACGAGCGTCGCCAGGAAGAGCAGCGCCAGGTCGATCCGGT
GCTGGGCCAGCTCGAGCGCCAGGAGGAAAGCCTCAATGCCACGCTCCTCGAACTGACCGACAGCCTGGGC
GGTGGCGCCAACGCTCGATACAAGCTGCCCTGGTATCTGGTGATGGGCGTCGAGAACGCCGGCAAGACCA
GCCTGATCAACCGCTCGGGGCAGAACTTCTCCCTGACCCACGTGATGAAGGCCTCCGGACAGGGCAAGCG
CGGGCGACTGGGCTTCGACTGGTGGATCGGCGACAAGGCAGTGCTGATCGATCCCGACGGCGAGCTGCTG
ACCCAGGGGGCCCTGCAGGGCGGTCAGCCGGCGGAACTCGAGAGTCGGCTATGGGACCACTTCGTCGACT
GGCTCGAGCGCCATCGTTCGCGTCGTCCGCTGGACGGCGTGGTGCTGGTGCTCGACCTGGCGCGGCTCAG
CGACGCCGAAGTGGCGGTACGCAAGGCCTACGCCTCGCTGCTGCGCGCCCGGCTGCGCGAGTTGATGGAG
CGCCACGGCAGCCGACTGCCGGTCTATGTCACCTTTAGCAAGATGGACCTGCTGCACGGGTTCGACGACT
TCTTCCGTCACTACTCCCGGGCCGCCCGACGGGCACCGCTCGGCTTCACGTTCTCCGCTGCTTCCCTCGA
GCGTCCCGGCCGTTGGGAGGAGGAGTTCGCCGAGGGTTACGACGACATGCTCGAGCGTCTCAACCAGACG
CTGCCGACCCTGCTCGTCGAGTGCCGTGATCGTGATGAGCGCGAGGCGGTATTCCGCTTCGTGCGACAGC
TCGCCGGCTTGCGCGACGTACTGCTTGGCTTCCTCGGTGAAGCGTTGTCCAGTGACCGTTTCTCCACGGC
GGCGCTGGTACGCGGGGCCTACTTCACCTCGGTCTATCAGCAAGGCGTGCCGGAAGATCCCTTCGTCGAT
GCCGCGGCACGGCGCTACGGGATGACCGACGGTGTGCAGGCGGCCCATCGGGCGACACGCTCGGCACTGT
ACTTCACCGAAGAGCTGTTCGAGCGCATCATCTATCCTGAGTCGGGGCTGGCCGGCGACAATGCCCGGGC
GGCACGGCGTCGACGTCGTATCCGTCGTGCCAGTGCACTGGGCTGTCTGTTCGTCGGCGCTGCCCTAGTC
GGTGGCTGGTACCACTTCTACGAGAAGAATTCCAAGGCCCTGGCGGCCGTGGAAGACAAGGCCGAGGCCT
TTCTCGCCGTGCGCCCGAGCGACTGGCAGAACGACGATCCTACCGGCTATGCGCTGCTCGAGCCGCTGGA
CCGCCTGCTCAGCGCCACGCAGGAATTCGGCGATTACCGCTCGCGGCCCTGGCTGCTGGCTGATATGGGC
CTCTATCAGGGACACGAGCTGGGCGTCGAGATCGACAATGGTTACCTGAGGTTGCTCGAGGAGCAATTCC
TGCCGGCGCTGATGATCGGCATCATGGACGACATGAACCGGGCACCGGAGGGCAGCAACGAGAAGCTGGC
GCTGCTGCGTATCCTGCGCATGATGTCCGACGCCAGCGGTCGTCAGCCTCAGCGCGTCCATGACTTCATG
GAGGATCGCTGGCAGGAGGCCTTCCCCGGTCGCGGCGAAGTCCAGCGTCGCCTGCTGGCGCATCTCGATT
ACGCCCTGGCTTACACCGACCTGGCAGGCCACGCCGAGGCCGGCCAGTCCGGCGCTCGTCAGGCCATGGC
GCCGCTCGATGGCAGCATCGAGGCCGCCCAGCAGGAACTCGCCCGCCAGCCGATGGCCGAGCGAGTATAT
GCCTCGCTCAAGTCCGGTATCGATGAACATCGCGCCGCACCGCTGGATCTGCGCTCGAGCGTCGGTTCGA
GCTTCAGCCTGGTGTTCATGGCCCGCGATGACAATCCTGAGCTGGTGCGCATTCCCGGCCTGCTGACGCG
CAATGGCTTCGAGGATTACTTCCTCGACCAGCTCGACCAGGCCACCGAGCTGGCGCTGGTCGATACCTGG
GTGCTCGGCCAGCGGGACGACATCGACTTCAGCGAAGCCGACCACCGTCAGCTTCAGGAAGCCCTGCGCG
AGCGCTATATCAGCGACTATCACGTCACCTGGCGCGAGGCGCTGGCCGACATCCGCATGGTGCCGCTGCC
CGATATCCATCAGGCGGTGGTGGTCGCCGACGGCCTGCTCAGCGCCAGTCGCCCGCTGGATCGCCTGCTT
GGCGAGGTCGCCGACCAGACCCGGCTCTATCCGGAACTGCCGGCGGACGACGAGGCCGCCCGAGCGGCCC
TGAAGAAATCGCCGCGCTACCAGCTGGCCAGCGAGATCGAGCGTCACTTCGCCGCGCTCAACGAGCTCAG
CGAAGAGCGGGGCGACAATCCCTCCAAGCTCGACGAGATCAAGTCTGCCATCGGTGACCTGCGCGACTAC
CTGCGCCAGGTCGATGAAGCCGACGAGCGTGGTCAGCGCGCCTTCCTACTGGCCCGCGACCGCATTTCCC
TGAAGGGCGAGGATCCCATCGCCCGCCTCAAGCGCATTGCCGAGGACGTCCCGGCGCCGGTGAGTGGCAT
GCTCGAGAGCCTGGCCGACCAGAGTTGGCAATTGCTGATGGCCAGCGCGGTTCGACACCTGGAGCACCAG
TGGGTGGATGAGGTCGTGAGACCCTTCCAGCAGGACCTTGCCGGCCGCTATCCGCTGGCGCCCCAGGCCT
CCCGCGAGGTGGCGCTGGCCGACTTCGAGGACTTCTTTGCCCCGGACGGCATTCTCGATGCCTTCTATCA
GCGCAACCTCAAGCCTTTCATCGAGGGCGCGCCGGAGGCCCTGCGCACCGACGGGGGCGACTCGCTGTTG
CGCCAGGGAGTGCTCGATGCCGTGCAGCGCGCCGAGCGTATCCGCGAGGCCTATCTCAACCGCGACGGTG
TGCTCGACGTGGCCTTCAGCCTCGAGCCGCTGAGCCTCAGTGCCGACAAGCGTCGCGGGGTGATCAGCGT
CGACGGCCAGTTGATCGACTATGCCCACGGCCCCAGCCGGCGGGTGCCGATGATCTGGCCCAACGGCCTG
CGTGAGAGCAACGAAAGCCGGGTCACCCTGGTGCCGAGCGAGGTCAACCATTCGCCGCGCACCCTGCGTC
GCGACGGTCCCTGGGCCTGGTTCCGGCTGCTCGACGAGGCCCAGTTGACCGGCACCGGCGAGCGCGAGCT
GGAGCTCAGCTTCGAGGTCGATGGTGGCAGCATGCGTTACCGGCTGACCGCCGATGGATCCCGCAATCCC
TTCACCCGGTCGCTGGTGGCGGGCTTCAACCTGCCCACGACCCTCTACGCAGCAGGAGGGCCGGACGATG
CTGACGACGCTTAA
 Primer design