SecReT6
Protein ID: 307726196
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4182
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]744668..745750 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE1TE89
KEGG IDbgf:BC1003_4182
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-25, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 5.20E-25, Aligned region: 160..179
Protein Sequence: 360 a.a.     [Download]
>gi|307726196|ref|YP_003909409.1| type VI secretion-associated protein, ImpA family [Burkholderia sp. CCGE1003]
MTDSYATNALLSPIDDAAPAGLNLEYDPAFTELELLATPTPERAMGDSLKAAQEPDWDKVASAAGALLTR
TKDLRVAVHLCCAQTHNEGLSGWAAGLGLVRGLLERYWDHVHPQLDADDNNDPTARANALMPLGDPQSAL
GIFRLAPFVQSPRLGRFSLRDLRVATGVTHASPSQDGAPAPTLVDLEACCMDCPEDQLPQSAATLAQAQE
HAEAIVALVREKLGTAGPDMALLCGDIAELKKFVDAQLLRRFPGRADAGVAASLASLLDLSSSPLSLHAN
GAPAGAMHEPANAGIASQADVILRLDEICDYYQRVEPSSPLPILLKRARRLVGKSFADVLKDIAPGGLSE
LQALSGPESE
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|307725550|ref|NC_014540.1|:744668-745750 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGACCGACTCCTACGCGACGAATGCCCTGCTTTCCCCCATCGACGATGCGGCGCCGGCCGGGCTCAACC
TCGAATACGATCCCGCCTTCACCGAGCTCGAACTGCTGGCGACACCCACGCCCGAGCGCGCGATGGGCGA
CAGTCTGAAAGCCGCTCAGGAGCCTGACTGGGACAAGGTCGCAAGCGCCGCCGGCGCGCTGCTTACGCGC
ACCAAAGATCTGCGCGTTGCAGTTCACCTCTGTTGCGCGCAAACCCATAACGAAGGTCTGTCCGGATGGG
CCGCGGGCCTAGGCCTCGTTCGCGGGCTGCTCGAACGCTACTGGGACCATGTGCATCCGCAATTGGACGC
CGACGACAACAACGACCCCACCGCCCGCGCCAATGCGCTGATGCCGCTTGGCGATCCGCAAAGCGCGCTG
GGCATTTTCAGGCTTGCTCCGTTCGTGCAGTCGCCACGTCTGGGCCGCTTTTCGCTGCGCGATCTGCGCG
TGGCAACCGGCGTGACCCACGCCTCGCCGTCGCAGGACGGCGCGCCGGCTCCGACGCTCGTCGACCTCGA
AGCGTGCTGCATGGATTGCCCCGAGGACCAACTGCCCCAATCGGCCGCAACGCTCGCGCAAGCACAGGAA
CATGCCGAGGCCATCGTCGCGCTGGTGCGGGAAAAACTCGGCACGGCCGGCCCCGACATGGCGCTGTTGT
GCGGCGATATCGCAGAGCTGAAAAAATTCGTCGATGCGCAACTGCTGCGCCGGTTTCCAGGCCGAGCGGA
CGCGGGTGTCGCCGCATCGTTGGCCTCGCTGTTGGACTTGTCTTCGTCGCCGTTGTCGCTCCACGCGAAC
GGCGCTCCCGCAGGCGCCATGCATGAGCCTGCGAACGCCGGAATTGCCAGCCAGGCTGATGTGATCCTGC
GGCTCGATGAGATTTGCGACTACTACCAGCGTGTCGAACCTTCGAGCCCTCTACCGATTTTGCTCAAACG
CGCACGGCGCCTCGTCGGCAAGAGCTTCGCCGACGTGCTCAAGGACATCGCGCCAGGCGGGCTGTCGGAA
CTTCAGGCATTGTCGGGCCCGGAGAGCGAATAA
 Primer design