SecReT6
Protein ID: 307726201
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4187
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]751516..755079 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE1TE94
KEGG IDbgf:BC1003_4187
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.10E-94, Aligned region: 190..453
IcmF-related [PF06761], Evalue: 8.00E-69, Aligned region: 439..487
IcmF-related [PF06761], Evalue: 8.00E-69, Aligned region: 503..803
DUF1215 [PF06744], Evalue: 6.50E-26, Aligned region: 930..1050
AAA_16 [PF13191], Evalue: 3.50E-07, Aligned region: 97..252
AAA_16 [PF13191], Evalue: 3.50E-07, Aligned region: 313..356
AAA_16 [PF13191], Evalue: 3.50E-07, Aligned region: 906..975
AAA_33 [PF13671], Evalue: 1.20E-05, Aligned region: 73..121
AAA_33 [PF13671], Evalue: 1.20E-05, Aligned region: 128..263
AAA_25 [PF13481], Evalue: 0.0039, Aligned region: 126..144
AAA_25 [PF13481], Evalue: 0.0039, Aligned region: 177..212
AAA_25 [PF13481], Evalue: 0.0039, Aligned region: 994..1041
Protein Sequence: 1187 a.a.     [Download]
>gi|307726201|ref|YP_003909414.1| type VI secretion protein IcmF [Burkholderia sp. CCGE1003]
MNTLKTWVKSRWFTHALGLLLIAALIWLGGPYVGIGEREPLASPAARVALILAVVLAWMIGLQVMHWRAQ
RKTARLSGDLAGQETRIAAAEPASEERAQLLQRFREAIHTLRTTRRNGRNLYALPWYVVIGPPGSGKSTL
LQNSGLDFPLSERFGKDALRGIGGTRNCDWWFTDEAVFLDTAGRYTTQDSDAQADAAAWQSFLALLRRYR
RRRPLNGVIVTMSVSDLLGFDDAAREQHARAVRRRLDELAQHLKVAVPVYLVFTKCDLVAGFGEFFDDLG
AQLRSQVWGMTFPLDASLDGSACSRFADEYDLLLNRLNTRLIERLHGERDRGRRAAVLSFPQQLGAFRDI
ARQFVEAAFGRHEYGTPPMLRGAYLSSGTQEGAPIDRVLGAVARTFGVDAARVQAGAGQRHTYFVERLLK
DVLFRESGLAGTNPRFERQKLFMQAAAYAGLVVVTLVLVAGFATSYARNRAFVAEIQSALKDLPDAATLA
GVPDIRSYFARALARLEVIAATQDAAGQYRAHVPWSMRFGLYQGNALYAQAHSAYLRELDGTLLPGVDLR
FREGLGENASNPQALYDDLKGYLMLGEPQHLDADELAALARVEWQRLFPQDPAIRTALDRHFSARLGDAQ
KPRALPLDPALIAQARSTLKTADVATLIYGSVRLDAGRSGVSPVRLDQSLGLLGNVFRRKSGTPLSEPLP
VLFTRPYFQSEVSGGLDQSVDRFVKDYWVFDSGRVDPLARSRYEQQVLTLYEQDYIASWDALLADLQLQP
VTSIQDASAMAAKLSGPSSPLKALLNLVRDNTSDMLRAPAGGGAAGADALASQARLAGENIAAKRALNTR
LAGELRNAGAPLPAGVTLKAGDANAAGSRQPGAAIEEHFAQINQLGAGTSGATPLDHSLAVLDQLGKTLL
TMNDLSDPAAQNSPALLAARQEAGQLPPQVAALIQGLTGKSADLVASGSSAALADQFRAAAGSDCANFVD
GRYPFAPGGGSDIPLQNFAELFGNGGRFDSFFKSTLAQRVDTGSRAWRWKPGAPPGPQSVLAGAQAADDI
RQMFFPNGAQPRVGFTLLAPQFEPPIARAVIEIDGQKYDYSANGASSVTMAWPGPQPGHVSVSAFDVAGR
PLGTPLRLNGEWAFFHALDAARLQKQGDLRYVASFDFDGHALRLPIQPASLRNPFDNNEVRRFRCPR
 
Nucleotide Sequence: 3564 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c755079-751516 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAACACGCTGAAAACCTGGGTCAAGTCCCGGTGGTTCACGCACGCGCTGGGCCTGCTGCTGATCGCGG
CGCTGATCTGGCTCGGCGGCCCTTACGTGGGCATTGGCGAACGCGAACCGCTCGCGAGCCCGGCGGCGCG
GGTCGCACTGATTCTCGCGGTGGTGCTCGCGTGGATGATCGGCTTGCAGGTTATGCACTGGAGAGCGCAG
CGCAAGACCGCGCGGCTCTCGGGCGACCTGGCGGGACAGGAGACGCGGATCGCCGCCGCGGAGCCCGCCA
GCGAGGAGCGCGCGCAACTGCTGCAACGCTTTCGTGAGGCGATTCACACGCTGCGCACGACGCGCCGTAA
CGGCCGCAACCTGTACGCGTTGCCGTGGTATGTCGTGATCGGGCCGCCCGGCTCGGGCAAGAGCACGTTG
CTGCAAAACTCCGGGCTCGACTTTCCGTTGTCCGAGCGCTTCGGCAAGGACGCGTTGCGCGGCATCGGCG
GCACACGCAACTGCGACTGGTGGTTCACCGACGAGGCCGTGTTTCTCGATACCGCGGGCCGCTACACGAC
TCAGGATTCCGATGCGCAAGCGGATGCGGCGGCATGGCAGTCGTTTCTCGCGCTGCTGCGCCGCTATCGC
AGGCGGCGGCCGTTGAACGGCGTGATCGTGACGATGAGCGTGTCCGACCTGCTCGGCTTCGACGACGCCG
CGCGCGAACAGCACGCGCGCGCCGTGCGCCGTCGTCTGGACGAGCTTGCGCAGCACCTGAAGGTGGCGGT
GCCCGTGTATCTCGTGTTCACCAAATGCGACCTGGTGGCGGGCTTCGGCGAGTTCTTCGACGATCTCGGC
GCCCAGTTGCGCAGCCAGGTGTGGGGCATGACGTTTCCTCTCGACGCGAGCCTCGACGGCAGCGCGTGCA
GTCGTTTCGCCGATGAATACGATCTGCTGCTCAACCGTCTCAACACGCGTCTGATCGAGCGCCTGCATGG
CGAGCGCGATCGTGGCCGACGTGCCGCGGTGCTGAGCTTTCCGCAGCAACTGGGTGCGTTTCGCGACATC
GCGAGGCAGTTCGTCGAGGCCGCGTTCGGGCGTCACGAGTACGGCACGCCGCCGATGCTGCGCGGGGCTT
ACCTGAGCTCCGGCACCCAGGAGGGTGCGCCGATCGACCGGGTGCTCGGAGCGGTTGCGCGCACTTTCGG
CGTGGACGCCGCGCGAGTGCAGGCCGGCGCCGGGCAGCGGCACACCTACTTCGTCGAGCGCCTGCTGAAG
GACGTGCTGTTTCGCGAGTCCGGTCTTGCGGGCACGAATCCGCGCTTCGAGCGGCAGAAGCTGTTCATGC
AGGCGGCCGCGTATGCGGGCCTTGTCGTCGTGACCCTCGTGCTGGTCGCGGGATTCGCGACCAGCTATGC
ACGCAACCGCGCATTCGTCGCCGAAATCCAGAGCGCGCTGAAGGACCTGCCCGACGCCGCGACGCTTGCC
GGCGTACCCGACATCAGGTCGTACTTCGCGCGGGCGCTCGCGCGGCTCGAGGTGATCGCCGCAACGCAGG
ACGCCGCGGGCCAGTACCGCGCCCACGTGCCGTGGTCGATGCGCTTCGGTCTGTATCAGGGCAACGCGCT
TTATGCGCAGGCGCACAGCGCGTATCTGCGCGAACTCGACGGCACCTTGCTGCCCGGCGTGGATCTGCGG
TTTCGCGAAGGTCTCGGCGAAAACGCCAGCAACCCGCAAGCGCTCTACGACGATCTGAAGGGCTACCTGA
TGCTCGGCGAGCCGCAGCATCTCGACGCGGACGAACTGGCCGCGCTTGCCCGCGTCGAGTGGCAGCGGCT
GTTCCCGCAGGACCCGGCGATTCGCACCGCGCTCGACAGGCACTTCTCGGCCCGGCTCGGCGACGCGCAG
AAACCGCGCGCGCTGCCGCTCGATCCCGCACTGATCGCTCAGGCGCGCTCGACACTGAAGACAGCGGACG
TCGCCACGCTGATTTACGGCAGTGTGCGATTGGACGCCGGGCGCTCGGGCGTCTCGCCGGTGCGGCTCGA
CCAGTCGCTCGGCTTGCTCGGCAATGTGTTCCGTCGCAAGAGCGGGACGCCGCTCTCCGAACCTTTGCCG
GTTCTCTTCACGCGGCCGTATTTCCAGTCGGAGGTGAGCGGCGGGCTGGACCAATCCGTCGATCGCTTCG
TGAAGGACTACTGGGTGTTCGACAGCGGGCGCGTCGATCCGCTGGCCCGCTCGCGTTACGAACAACAGGT
GCTGACGCTTTACGAGCAGGACTACATCGCAAGCTGGGATGCGTTGCTCGCCGATCTGCAGTTGCAACCT
GTCACGAGCATTCAGGACGCGAGCGCGATGGCCGCGAAACTGTCCGGACCGAGTTCGCCGCTCAAGGCGC
TGCTCAATCTGGTTCGCGACAATACGAGCGACATGTTGCGCGCGCCGGCAGGCGGCGGCGCGGCGGGCGC
CGATGCGTTGGCCTCGCAGGCGAGGCTTGCCGGCGAAAACATCGCGGCGAAGCGCGCGCTGAACACGCGG
CTCGCGGGCGAACTGCGCAACGCCGGCGCGCCGCTGCCCGCCGGCGTGACGCTGAAGGCGGGCGATGCGA
ATGCGGCCGGTTCGCGGCAGCCGGGCGCCGCCATAGAAGAACACTTCGCGCAGATCAATCAGCTCGGCGC
GGGCACGAGCGGCGCGACGCCGCTCGACCACAGCCTGGCCGTCCTCGATCAGCTCGGCAAAACTCTGCTG
ACCATGAACGACCTGAGCGACCCTGCCGCACAGAATAGCCCGGCGCTGCTCGCCGCGCGCCAGGAAGCGG
GGCAACTGCCGCCGCAGGTGGCCGCGCTGATTCAGGGGCTCACCGGCAAGAGCGCCGATCTGGTTGCTAG
CGGCAGCAGCGCGGCGCTTGCCGATCAGTTCCGCGCGGCGGCGGGCAGCGACTGCGCCAACTTTGTCGAC
GGACGCTATCCGTTTGCACCGGGCGGCGGGTCGGACATTCCGCTGCAGAACTTTGCCGAACTGTTTGGCA
ACGGCGGCAGATTCGACAGTTTCTTTAAATCGACGCTTGCGCAGCGAGTCGATACCGGCAGCCGTGCATG
GCGCTGGAAACCGGGCGCGCCGCCGGGACCGCAGTCGGTACTGGCCGGCGCGCAGGCTGCGGACGACATC
CGCCAGATGTTCTTTCCGAACGGTGCCCAGCCCCGGGTTGGCTTCACGCTGCTCGCACCGCAGTTCGAGC
CGCCTATCGCGCGGGCCGTGATCGAGATCGACGGGCAGAAATACGACTATTCGGCTAACGGGGCGTCGAG
CGTGACAATGGCATGGCCGGGCCCGCAGCCGGGCCACGTGTCGGTCAGCGCTTTCGACGTGGCGGGCCGT
CCGCTGGGTACGCCGTTGCGTCTCAATGGCGAATGGGCGTTCTTCCATGCGCTCGACGCCGCTCGCCTGC
AAAAGCAGGGCGATCTTCGCTATGTGGCGAGCTTCGATTTCGACGGTCACGCGCTCAGGCTGCCGATCCA
GCCGGCGAGTCTGCGCAATCCGTTCGATAACAATGAAGTGCGGCGCTTCAGGTGCCCGCGATGA
 Primer design