SecReT6
Protein ID: 307726202
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4188
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]755084..756421 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDE1TE95
KEGG IDbgf:BC1003_4188
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.00E-65, Aligned region: 63..266
OmpA [PF00691], Evalue: 3.80E-12, Aligned region: 336..434
Protein Sequence: 445 a.a.     [Download]
>gi|307726202|ref|YP_003909415.1| type IV / VI secretion system protein, DotU family [Burkholderia sp. CCGE1003]
MSTANRNDQQAGRIDATVIRPQPRAGADDATLIMPRHAPARAHEPASAAPRIELAELMSGVVNPLVRAAN
PLLLLSVQLRHSVAAPADVARLREQAVAHVHSFERHAQDAGVNTQTVVAARYVLCTMLDEAVNNAPWGDL
SGWAQKTLLVTFHGEAYGGAKFFQILERLSVDFSRHLDLIEMMYICLALGFGGRYLVEPGGLGRLADIQD
DLYRRIRGLREAPAAELAPHWRGVDDRRNPVMRHVPLWIAAIASAVVVIGAFLYFFTRLNALAEPVGAQL
AAIGPGSAPPPGNAAAPKPARNSLKALLAPLEQSGALTVDEQSDGRDTIRLAAGALFPSGGADLAPDEIP
LLRRVASALNQVRGRVIVVGHTDDQPVHSLRFKDNFALSTARAQNTLAVLAQGLDDPRRLEANGAGSSQP
VATPADLPANRARNRRVEILFIPEN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c756421-755084 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAGCACCGCCAATCGCAACGATCAGCAGGCCGGGCGCATCGACGCCACGGTCATCCGCCCGCAGCCTC
GAGCGGGCGCCGACGACGCCACCCTAATCATGCCGCGGCACGCGCCTGCGCGCGCTCACGAACCAGCTTC
TGCCGCGCCGCGCATCGAACTGGCCGAACTGATGAGCGGCGTCGTCAATCCGCTCGTGCGCGCCGCCAAT
CCGCTGCTGCTCCTTAGCGTGCAGTTGCGGCACAGCGTGGCGGCGCCCGCCGACGTCGCGCGGCTGCGCG
AGCAGGCCGTCGCTCATGTGCACAGCTTCGAGCGTCACGCGCAGGACGCCGGTGTCAACACGCAAACCGT
CGTGGCCGCGCGTTACGTGCTGTGCACCATGCTCGACGAAGCCGTGAACAATGCGCCGTGGGGCGACCTC
AGCGGCTGGGCGCAAAAGACGCTGCTCGTGACGTTTCACGGCGAGGCCTACGGCGGCGCCAAGTTCTTCC
AGATTCTCGAGCGGCTGAGCGTGGACTTTTCGCGGCATCTCGATCTGATCGAGATGATGTACATCTGCCT
CGCGCTCGGTTTCGGCGGACGTTATCTGGTGGAGCCGGGCGGGCTCGGCCGTCTTGCCGACATTCAGGAC
GATCTGTATCGCCGGATTCGCGGTTTGCGCGAAGCGCCCGCTGCCGAACTGGCGCCGCACTGGCGCGGCG
TCGACGACCGCCGCAATCCGGTCATGCGTCACGTGCCGCTGTGGATCGCGGCTATCGCGTCGGCGGTCGT
CGTGATCGGCGCGTTCCTGTATTTCTTCACGCGCCTCAATGCGCTCGCGGAGCCGGTCGGCGCACAGCTT
GCCGCGATCGGTCCCGGCAGCGCGCCGCCGCCTGGCAATGCCGCCGCACCGAAGCCGGCGCGCAACAGCC
TGAAGGCGCTGCTTGCGCCGCTTGAACAATCCGGCGCACTGACCGTCGACGAGCAGTCCGACGGCCGCGA
CACGATACGTCTTGCGGCAGGCGCGCTGTTTCCCTCGGGCGGAGCAGACCTTGCCCCCGACGAAATTCCG
CTGCTGCGCCGCGTGGCTTCGGCGCTCAACCAGGTGCGCGGGCGCGTGATCGTGGTGGGCCATACCGACG
ATCAACCGGTGCACTCGCTCAGATTCAAGGACAACTTCGCGCTCTCGACGGCGCGCGCGCAGAACACGCT
CGCGGTGCTCGCACAAGGACTCGACGATCCGCGCCGGCTGGAGGCAAACGGTGCCGGTTCGTCGCAGCCG
GTCGCGACGCCGGCCGACCTGCCGGCCAACCGGGCGCGCAACCGTCGCGTGGAAATTCTGTTTATCCCGG
AGAACTGA
 Primer design