SecReT6
Protein ID: 307726203
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4189
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]756418..757758 [-]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDE1TE96
KEGG IDbgf:BC1003_4189
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.00E-154, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|307726203|ref|YP_003909416.1| type VI secretion protein, VC_A0114 family [Burkholderia sp. CCGE1003]
MTHSNKVIWSEGLFLRPQHMQQQERYFERYVELRAGALRPHGWGFQELELEPDLLAIGKLGIKRARGVFP
DGTPFSMPGDDPLPAPLDIDPNWRDQVVHLSLPLRSPTRPDSGWSGAGSADQLLRYRVRETEVHDASGSM
EGLTVLEVAGMSTRLMPQSQPAEGLMQIPLARVIECRADRRVTLDDGFMPSALQTQAAERLVTFLSELLG
LLHQRGEALAIRVTQTDRGGAAEIADFLMLQVINRYQPLVAHLAEAPLLHPEALYQLLLELAGELATFTA
PAKRAQSFPAYRHELLRESFEPVIGALRIALSAVLEQSAVAIPLQQRKYGVWVGVVPDSTLLDTASFVLA
ARADMKAEDMRRQLPTQSKIGPVERIRDLVNLQLPGIGVSSMPVAPRQLPYTSGFVYFECDRGSPMWRML
KTSGGIAMHFGSGFPGLDLQLWAVRA
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c757758-756418 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGACCCACAGCAACAAAGTCATATGGAGCGAAGGCTTGTTCCTCAGGCCGCAGCACATGCAGCAGCAGG
AGCGCTATTTCGAGCGCTACGTGGAACTGCGCGCGGGCGCGCTGCGCCCGCATGGCTGGGGCTTCCAGGA
GCTCGAACTCGAACCCGACCTGCTCGCGATAGGCAAGCTCGGCATCAAACGCGCGCGGGGCGTGTTCCCC
GACGGCACGCCGTTCTCGATGCCGGGCGACGACCCGTTGCCCGCGCCGCTCGACATCGATCCGAACTGGC
GGGACCAAGTCGTTCATCTGAGCCTGCCGCTGCGCTCGCCGACGCGGCCCGACAGCGGCTGGAGCGGCGC
GGGCAGCGCCGATCAGCTATTGCGCTATCGGGTTCGCGAAACGGAAGTCCACGACGCGTCCGGCAGCATG
GAAGGGCTCACCGTGCTCGAAGTCGCGGGCATGAGCACGCGGCTCATGCCGCAGTCGCAGCCCGCCGAGG
GACTGATGCAGATTCCGCTTGCCCGCGTGATCGAATGCCGGGCAGACCGGCGCGTGACGCTCGATGACGG
TTTCATGCCGAGCGCGTTGCAGACGCAGGCCGCCGAGCGCCTCGTGACGTTCCTGTCGGAACTGCTCGGC
CTGCTTCACCAGCGCGGCGAAGCGCTCGCGATTCGCGTCACGCAAACAGATCGGGGCGGTGCCGCGGAGA
TCGCCGACTTCCTGATGCTTCAGGTCATCAACCGTTATCAGCCGCTCGTGGCGCATCTGGCCGAAGCGCC
GCTGTTGCATCCCGAAGCGCTGTACCAGTTGCTGCTCGAACTGGCCGGCGAACTGGCCACCTTCACTGCG
CCCGCCAAGCGCGCACAGAGCTTTCCCGCATACCGGCACGAACTGCTGCGGGAGAGCTTCGAGCCGGTGA
TCGGCGCATTGAGGATCGCGCTGAGCGCCGTGCTCGAACAGAGCGCGGTGGCTATTCCACTGCAACAACG
CAAGTACGGCGTCTGGGTCGGCGTGGTGCCCGATTCGACGCTGCTCGACACGGCGAGCTTCGTGCTCGCC
GCGCGAGCCGACATGAAGGCCGAAGACATGCGCAGGCAGTTGCCCACGCAATCGAAAATCGGCCCCGTGG
AGCGAATTCGCGATCTCGTCAATCTGCAACTGCCGGGCATCGGCGTTTCGTCGATGCCGGTTGCGCCGCG
CCAGTTGCCCTATACGTCCGGCTTCGTGTATTTCGAGTGCGACCGCGGTTCGCCGATGTGGCGCATGTTG
AAGACCTCCGGCGGCATCGCCATGCATTTCGGCAGCGGCTTTCCCGGTCTCGATCTTCAACTGTGGGCGG
TTCGCGCATGA
 Primer design