SecReT6
Protein ID: 307726204
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4190
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]757830..759518 [-]
ProductFHA domain containing protein
NoteFha
UniProt IDE1TE97
KEGG IDbgf:BC1003_4190
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-16, Aligned region: 33..96
Protein Sequence: 562 a.a.     [Download]
>gi|307726204|ref|YP_003909417.1| FHA domain containing protein [Burkholderia sp. CCGE1003]
MSTAHSLVLSVQGERGERLGGRREHVFDCRDGSIGRSEDCDWVLGTEGVSRLHALVRYLNGLYFVEDRST
NGMLLNGAALQRGDPAALKDGDRLQIDTFDIAVRVRGETVEQDRSSRDVSKEVRKAPAPAPLAVPSPAAD
VGAERAHNAEPLDLSVLLPSRGAGVSGGAGFAEGLIPGAADAAAGGSSLDPLALFDAPPSYFTEAASAAP
APAAPAPEWNHMPAVADRFRPPQVEQPRASGPLLPDDWDATASKVEPRSGAQPEPGDGERIAGISTDPSQ
TPDSPQPVDLQHSPRASADIPESAVAPVSSVAAGAAVSPIDPVAPAPVTQAFATSPALPTSRALGSSAAS
AASEGSAASPAQPASPPPPATPTPGAATTSALPPASADAQSQQLTDMLHIAVDAMMDVLRARAELKNRFR
LPATLIQRSENNPLKFAPTAQEAVRRLFAPPDGGFLSGNAALNDAAADIRNHQMAMLAGVRSAFQSMLAQ
FDPARIEESEGRARRLPLGGRPRHWERYKEQFDALTRDPDECFRRLFGDEFARAYEQQLAHLKARASDDP
PA
 
Nucleotide Sequence: 1689 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c759518-757830 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAGCACGGCGCACAGTCTGGTTCTTTCGGTGCAGGGCGAACGGGGCGAGCGTCTCGGCGGCCGGCGCG
AACACGTGTTCGATTGTCGCGACGGCAGCATCGGCCGCTCGGAAGACTGCGACTGGGTACTCGGCACCGA
AGGTGTGTCGCGGCTGCATGCTCTGGTGCGCTATCTGAACGGCCTCTATTTCGTCGAGGACCGCAGCACC
AACGGCATGCTGCTCAATGGCGCCGCTTTGCAAAGGGGCGATCCAGCGGCGCTGAAAGACGGTGACCGGT
TGCAGATAGATACCTTCGACATCGCCGTGCGTGTTCGCGGCGAGACGGTGGAACAGGACCGTAGCTCGCG
CGACGTATCGAAGGAGGTTCGCAAAGCGCCGGCGCCCGCGCCATTGGCAGTACCGTCGCCCGCCGCCGAC
GTGGGAGCGGAGCGCGCGCACAACGCCGAGCCGCTCGATCTGAGCGTGCTGCTGCCGTCCCGAGGCGCCG
GCGTGTCTGGCGGCGCAGGCTTTGCTGAAGGTCTGATTCCCGGTGCGGCCGACGCCGCCGCGGGCGGCTC
GAGCCTCGATCCGCTCGCGCTCTTCGACGCACCGCCATCGTATTTCACCGAGGCCGCATCCGCGGCTCCG
GCTCCGGCGGCGCCGGCGCCGGAATGGAATCACATGCCAGCGGTCGCGGACCGGTTCCGTCCGCCGCAAG
TGGAACAGCCGCGAGCCAGCGGGCCGCTTTTGCCCGACGATTGGGACGCAACCGCGAGCAAGGTCGAACC
ACGTTCCGGGGCGCAACCGGAGCCGGGCGATGGCGAGCGTATCGCTGGAATCTCGACGGACCCGTCGCAG
ACGCCGGACTCGCCGCAGCCGGTGGATTTGCAGCATTCGCCGCGGGCTAGCGCGGATATTCCGGAGTCCG
CCGTCGCGCCGGTCTCATCCGTTGCGGCCGGCGCAGCGGTTTCGCCAATCGACCCGGTGGCACCGGCGCC
GGTGACGCAGGCGTTTGCAACGTCACCTGCGTTACCAACGTCGCGTGCCTTAGGCTCTTCAGCGGCCTCA
GCAGCCTCAGAAGGCTCAGCGGCCTCACCAGCCCAACCAGCATCACCACCGCCACCGGCGACCCCCACTC
CCGGCGCCGCAACAACCAGCGCGCTCCCGCCGGCATCCGCCGACGCGCAGTCGCAGCAATTGACCGACAT
GCTCCACATCGCGGTGGACGCGATGATGGACGTGCTGCGCGCCCGCGCCGAACTGAAGAACCGTTTCCGG
CTACCCGCAACGCTGATCCAGCGTTCGGAGAACAACCCGCTCAAGTTCGCGCCGACCGCGCAGGAAGCGG
TCCGAAGGCTGTTCGCGCCGCCGGACGGCGGCTTCCTGTCCGGCAACGCGGCGCTCAACGACGCCGCCGC
CGACATCCGCAATCACCAGATGGCAATGCTCGCCGGCGTGCGCTCGGCGTTCCAGTCGATGCTGGCCCAG
TTCGATCCCGCGCGGATCGAAGAGTCGGAAGGCCGCGCGCGACGCTTGCCGCTCGGTGGGCGGCCGCGTC
ACTGGGAGCGCTACAAGGAGCAGTTCGACGCGCTCACCCGAGACCCCGATGAATGCTTTCGGCGCCTGTT
CGGCGACGAATTCGCGCGGGCCTACGAGCAGCAGCTCGCGCACCTCAAAGCCCGCGCCAGCGACGACCCG
CCAGCGTGA
 Primer design