SecReT6
Protein ID: 307726206
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4192
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]760060..761949 [-]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDE1TE99
KEGG IDbgf:BC1003_4192
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-75, Aligned region: 23..334
Phage_base_V [PF04717], Evalue: 1.70E-23, Aligned region: 377..469
Protein Sequence: 629 a.a.     [Download]
>gi|307726206|ref|YP_003909419.1| type VI secretion system Vgr family protein [Burkholderia sp. CCGE1003]
MAHAITLASNLGANLLFSNMTATESLGRLFSYRIEAISKNPQIDLRTLLGTPMTVKLVTPQGYTRYFNGM
VNECEQGGFVNIENVRYAVYTFGVVPKPWLATRRRDCRIYRSMSVPQIVKSVLADAGYADVKLSLSGSYA
PRDYCVQYRESSFDFISRLMEQEGIYYFFTHGDGVHTMVLADALGAHSPVGGFEQIPYAPPTERGKRMKA
SISDWSSARTINATRVQLDDYDYLKPKASLLATEDVTDKDDAHGVSGLDIYDYSYDYVGHDQRLQDGQRY
AQVRADALNVPMLTSAGHTDACGLATGALFRLKDFPLAEANQEYLVIETEMRLVEPDYVTGGGADEDEGP
FHCAFRAIRSRQPFRTMPLTPRPVIAGLQTAVVEGNTPEDIAVDKYGRVQVTFFWNRPAKPNAQNSCPVR
VAQMWAGKRWGAQFIPRVGQEVVVSFLDGNPDRPLIIGSVYNADNMPPYGLPENRTQSGVKSRSHNGSAE
DYNEIRFEDKKGSEEVLIHAQKNLREESEHDHDVEVARNYTLTAGKQIRLVTGLASITLNSTGEIAIEGT
NVTINGELNVAMTSGLAMELNSKANLNISSIAAMEILSEADCLVQSTNLQLIGTASAILGGAAPMILPL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c761949-760060 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGCTCACGCAATTACGCTCGCTTCGAACCTCGGCGCCAATCTGCTGTTCTCGAACATGACCGCGACTG
AATCGCTCGGCCGTCTTTTTTCATACCGGATAGAGGCGATCAGCAAGAACCCGCAGATCGATTTGCGCAC
GCTGCTCGGCACGCCGATGACAGTCAAGCTCGTCACTCCGCAAGGCTATACGCGGTACTTCAACGGTATG
GTCAACGAGTGCGAGCAGGGCGGCTTCGTGAACATCGAAAACGTGCGTTATGCCGTCTACACGTTCGGCG
TCGTGCCGAAGCCGTGGCTTGCGACGCGTCGGCGCGACTGTCGCATTTATCGAAGCATGAGCGTGCCGCA
GATCGTCAAGTCGGTGCTCGCCGACGCCGGCTATGCAGACGTGAAACTGAGCCTGAGCGGGAGCTACGCG
CCGCGCGACTACTGCGTGCAGTACCGCGAGAGCAGCTTTGACTTCATTAGCCGGTTGATGGAGCAGGAAG
GCATCTACTACTTCTTTACGCATGGGGACGGTGTGCACACCATGGTGCTGGCCGATGCGCTCGGCGCTCA
TTCACCTGTGGGCGGCTTCGAGCAGATCCCTTATGCGCCGCCCACTGAACGCGGCAAACGCATGAAGGCG
TCGATCAGCGACTGGAGCTCCGCGCGCACGATAAATGCAACGCGCGTGCAACTGGACGACTACGACTATC
TGAAACCGAAAGCGTCGCTGCTCGCTACCGAGGACGTCACCGACAAGGACGATGCCCACGGCGTGAGCGG
TCTCGACATCTACGACTACTCGTACGACTACGTGGGTCACGACCAGCGCCTGCAGGACGGTCAGCGCTAC
GCGCAGGTGCGCGCCGATGCGCTCAACGTGCCGATGCTGACGAGCGCCGGGCACACCGACGCATGCGGTC
TCGCCACCGGTGCATTGTTCAGGCTGAAGGACTTTCCGCTTGCGGAGGCGAACCAGGAGTATCTCGTGAT
CGAAACCGAGATGCGGCTCGTCGAGCCGGACTACGTGACGGGCGGCGGCGCGGACGAGGACGAGGGGCCG
TTTCACTGTGCGTTCAGGGCGATTCGTAGCCGTCAGCCGTTTCGCACCATGCCGCTTACACCGCGCCCCG
TGATTGCCGGCTTGCAGACCGCGGTGGTCGAAGGCAACACGCCGGAAGATATCGCCGTCGACAAGTATGG
CCGGGTGCAGGTCACGTTCTTCTGGAACCGCCCGGCCAAGCCGAACGCCCAGAATTCTTGCCCGGTGCGC
GTCGCGCAGATGTGGGCGGGCAAGCGCTGGGGCGCGCAGTTTATTCCGCGCGTCGGACAGGAGGTGGTGG
TCAGCTTTCTCGACGGCAACCCGGACCGGCCGTTGATTATCGGCAGCGTCTATAACGCGGACAACATGCC
GCCGTACGGCCTGCCCGAAAACCGCACGCAAAGCGGCGTGAAAAGCCGCAGCCACAACGGCTCCGCCGAG
GACTACAACGAAATCCGCTTCGAGGACAAAAAGGGCAGCGAAGAGGTGCTGATTCATGCGCAGAAAAATT
TGCGCGAGGAATCGGAGCATGACCACGACGTTGAGGTGGCGCGCAACTACACGCTCACGGCCGGCAAGCA
GATCAGGCTCGTGACCGGGCTCGCGAGCATCACGCTGAACAGCACCGGCGAGATCGCGATCGAGGGCACC
AACGTCACGATAAACGGCGAACTCAACGTGGCAATGACCTCGGGCCTCGCGATGGAACTCAACTCCAAGG
CGAATCTGAACATCAGTTCGATTGCCGCGATGGAAATCCTGTCCGAGGCCGACTGCCTCGTGCAGTCCAC
CAACCTGCAACTGATCGGCACGGCCAGCGCAATACTTGGCGGCGCGGCGCCGATGATCCTGCCGCTATGA
 Primer design