SecReT6
Protein ID: 307726209
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4195
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]763938..766748 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE1TEA2
KEGG IDbgf:BC1003_4195
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.60E-40, Aligned region: 236..252
AAA_2 [PF07724], Evalue: 7.60E-40, Aligned region: 654..820
AAA [PF00004], Evalue: 1.40E-17, Aligned region: 236..348
AAA [PF00004], Evalue: 1.40E-17, Aligned region: 660..744
ClpB_D2-small [PF10431], Evalue: 2.70E-14, Aligned region: 827..901
AAA_5 [PF07728], Evalue: 1.20E-11, Aligned region: 236..256
AAA_5 [PF07728], Evalue: 1.20E-11, Aligned region: 659..764
AAA_16 [PF13191], Evalue: 6.70E-09, Aligned region: 133..174
AAA_16 [PF13191], Evalue: 6.70E-09, Aligned region: 214..256
AAA_16 [PF13191], Evalue: 6.70E-09, Aligned region: 280..315
AAA_16 [PF13191], Evalue: 6.70E-09, Aligned region: 465..490
AAA_16 [PF13191], Evalue: 6.70E-09, Aligned region: 632..704
AAA_16 [PF13191], Evalue: 6.70E-09, Aligned region: 724..745
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 232..313
AAA_25 [PF13481], Evalue: 2.00E-07, Aligned region: 656..685
Sigma54_activat [PF00158], Evalue: 4.40E-07, Aligned region: 220..249
Sigma54_activat [PF00158], Evalue: 4.40E-07, Aligned region: 630..777
AAA_22 [PF13401], Evalue: 2.80E-06, Aligned region: 63..111
AAA_22 [PF13401], Evalue: 2.80E-06, Aligned region: 236..316
AAA_22 [PF13401], Evalue: 2.80E-06, Aligned region: 358..402
AAA_22 [PF13401], Evalue: 2.80E-06, Aligned region: 658..682
AAA_22 [PF13401], Evalue: 2.80E-06, Aligned region: 721..745
Zeta_toxin [PF06414], Evalue: 9.70E-05, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 9.70E-05, Aligned region: 653..699
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 233..256
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 657..681
NACHT [PF05729], Evalue: 0.00012, Aligned region: 237..268
NACHT [PF05729], Evalue: 0.00012, Aligned region: 659..687
AAA_17 [PF13207], Evalue: 0.0012, Aligned region: 237..252
AAA_17 [PF13207], Evalue: 0.0012, Aligned region: 659..695
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 238..316
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 362..402
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 658..740
IstB_IS21 [PF01695], Evalue: 0.003, Aligned region: 220..253
IstB_IS21 [PF01695], Evalue: 0.003, Aligned region: 659..679
AAA_18 [PF13238], Evalue: 0.0049, Aligned region: 237..255
AAA_18 [PF13238], Evalue: 0.0049, Aligned region: 661..688
AAA_29 [PF13555], Evalue: 0.0064, Aligned region: 228..252
AAA_29 [PF13555], Evalue: 0.0064, Aligned region: 658..684
Hpr_kinase_C [PF07475], Evalue: 0.0079, Aligned region: 236..247
Hpr_kinase_C [PF07475], Evalue: 0.0079, Aligned region: 657..678
Protein Sequence: 936 a.a.     [Download]
>gi|307726209|ref|YP_003909422.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1003]
MAEISRGALFGKLNSLAYRSIESATVFCKLRGNPYVEMAHWVHQILQLQDSDLHRIVRHFDVDPSNLARD
LTAALERLPRGNTTISDLSADVEETVERAWVFATLMFGEAQVRTGYLLVGALRTRHLRNALHALSAEFAK
VKAEALADAFGEIVAGSPEDRLEATDGFRLGPAPAPGENSGSIAPAQMGRQQALQQFTVDLSAQAREGRL
DSVIGRDGEIRQLIDILMRRRQNNPMLVGEAGVGKTAVVEGFALRIAGGDVPPALKDVVVRTLDVGLLQA
GASMKGEFENRLRQVIDEVQASPRPVILFIDEAHTLVGAGGAAGTLDAANLLKPALARGTLRTIGATTWA
EYRKHIEKDPALTRRFQTVPVDEPDEEKAILMMRGVASAMEQHHRVQILDEALEAAVALSHRYIPARQLP
DKSVSLLDTACARVAISQHATPAEIDDMSKQIEALETEQKIIEREKSVGIDVNEREARVALALETARARR
SQRESEWAGEKALVERILTLRAQLRGGSAAVDKASEGVARPAEAEADGITQTGTASAPAFADAPAPDSST
QADMLAELKRLQAELAGLQGESPLILPSVDYQAVASVVSDWTGIPVGRMVRSELKTVMNLATVLGERVIG
QDHAMEAIAKRIQTSRAGLDNPDRPVGVFMLAGTSGVGKTETALALAEALYGGEQNLITINMSEFQEAHT
VSTLKGAPPGYVGYGEGGVLTEAVRRKPYSVVLLDEIEKAHPDVHELFFQVFDKGVMEDGEGRSINFRNT
LILLTTNVGTERIAQLCSRPTAMPDAEALAKALREPLLDVFPPALLGRLVAIPYFPLSVDMLARIVTLQI
NRIKRRVEERYRVAFDYDDEVVRLIVGRCTESESGGRMIDAILTNTMLPAISREFLARLIDGGAIGQVRV
SVEQGDFAYSFDACAPAVTAPADALA
 
Nucleotide Sequence: 2811 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c766748-763938 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGCCGAGATCAGTCGCGGCGCGCTGTTCGGCAAGCTCAATTCGCTTGCCTACCGGAGCATCGAAAGCG
CCACCGTGTTTTGCAAACTGCGCGGCAACCCGTACGTCGAGATGGCGCATTGGGTGCATCAGATCCTGCA
ATTGCAGGACTCCGACCTGCACCGTATCGTCAGGCACTTCGACGTGGACCCGTCGAATCTCGCTCGCGAT
CTGACCGCGGCGCTCGAGCGTCTGCCGCGCGGCAATACGACGATCAGCGATCTCTCCGCCGACGTGGAGG
AAACCGTCGAGCGCGCCTGGGTCTTCGCCACGCTGATGTTCGGCGAGGCTCAGGTTCGCACGGGCTATCT
GCTCGTCGGCGCGCTGCGCACGCGCCATTTGCGCAACGCGCTGCACGCGTTGTCCGCCGAATTCGCCAAA
GTGAAGGCGGAGGCGCTGGCGGATGCGTTCGGTGAGATCGTCGCGGGATCGCCGGAAGACCGCCTCGAGG
CGACCGACGGTTTCCGTTTGGGGCCGGCGCCCGCGCCTGGCGAGAACAGCGGCTCGATTGCGCCGGCGCA
GATGGGCAGACAGCAGGCGTTGCAGCAATTCACAGTCGATCTGAGCGCCCAGGCGCGCGAGGGCCGGCTC
GATTCTGTGATCGGGCGCGACGGCGAGATTCGCCAGCTCATCGACATACTCATGCGCCGCCGCCAGAACA
ACCCGATGCTGGTGGGCGAGGCGGGCGTCGGCAAGACCGCCGTTGTCGAGGGCTTTGCGCTGCGGATCGC
GGGCGGCGACGTGCCGCCGGCGCTCAAGGACGTGGTGGTGCGCACGCTCGATGTCGGGTTGTTGCAGGCC
GGCGCCAGCATGAAGGGCGAGTTCGAAAACCGGCTGCGGCAGGTGATCGACGAAGTTCAGGCGTCGCCGA
GGCCAGTGATTCTCTTTATCGACGAGGCGCACACACTGGTCGGCGCGGGCGGCGCGGCCGGCACCTTGGA
CGCGGCGAATCTGCTCAAGCCGGCGCTTGCGCGAGGCACGCTGCGCACGATCGGCGCGACGACATGGGCC
GAGTATCGCAAGCACATCGAAAAGGACCCGGCCTTGACGCGGCGGTTCCAGACGGTGCCCGTCGACGAGC
CCGATGAAGAAAAGGCCATTCTGATGATGCGCGGTGTCGCGAGCGCGATGGAACAGCATCACCGGGTGCA
GATTCTCGACGAGGCGCTCGAAGCGGCCGTCGCGCTGTCGCATCGTTATATTCCTGCGCGCCAGTTGCCG
GACAAGTCGGTGAGCCTGCTCGACACGGCTTGTGCGCGGGTGGCGATCAGCCAGCATGCGACGCCTGCCG
AAATCGACGACATGTCCAAGCAGATCGAGGCGTTGGAGACCGAACAAAAAATCATCGAGCGCGAAAAAAG
CGTGGGTATCGACGTGAACGAGCGCGAGGCACGCGTCGCGCTTGCACTCGAGACAGCACGCGCGCGCCGC
TCGCAACGCGAGTCGGAATGGGCCGGAGAAAAAGCGCTGGTGGAGCGGATTCTGACGCTGCGTGCGCAAC
TGCGCGGCGGTAGTGCCGCGGTCGATAAAGCGAGTGAAGGTGTCGCGCGGCCGGCAGAGGCCGAGGCGGA
CGGGATCACGCAAACGGGTACGGCCTCGGCGCCTGCGTTCGCAGATGCGCCCGCGCCCGACTCTTCCACG
CAGGCGGACATGCTTGCAGAGCTCAAGCGGCTGCAAGCCGAGCTCGCCGGACTCCAGGGCGAGTCTCCGT
TGATCCTGCCGAGCGTCGATTATCAGGCGGTCGCCTCGGTCGTCTCGGATTGGACCGGCATTCCCGTCGG
GCGAATGGTGCGCAGCGAACTGAAGACCGTGATGAATCTGGCGACCGTGTTGGGCGAGCGCGTGATCGGC
CAGGACCATGCGATGGAAGCAATCGCAAAGCGCATTCAAACCTCGCGCGCCGGCCTCGACAATCCCGATC
GTCCGGTTGGCGTGTTCATGCTCGCGGGCACCTCCGGCGTCGGCAAGACCGAGACCGCGCTGGCACTGGC
CGAGGCGCTGTACGGCGGCGAGCAGAACCTCATCACGATCAACATGAGCGAGTTCCAGGAGGCGCACACG
GTGTCCACGCTCAAGGGCGCGCCGCCGGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACAGAAGCGG
TGCGTCGCAAGCCGTATTCCGTGGTGCTGCTCGACGAGATCGAGAAGGCGCATCCGGACGTGCACGAACT
GTTCTTCCAGGTCTTCGACAAGGGCGTGATGGAAGACGGCGAAGGCCGCTCGATCAACTTCCGCAACACG
CTGATTCTGCTGACGACGAACGTCGGCACCGAGCGGATCGCACAGCTTTGCAGCCGCCCGACCGCCATGC
CGGATGCCGAGGCGCTCGCAAAGGCGCTGCGCGAGCCGTTACTGGACGTGTTTCCGCCCGCGCTGCTCGG
CCGGCTCGTCGCGATTCCGTACTTCCCGCTCAGCGTTGACATGCTGGCGCGAATCGTCACGCTGCAGATA
AACCGCATCAAGCGTCGCGTGGAGGAGCGCTACCGCGTGGCGTTCGACTATGACGACGAGGTTGTTCGCC
TGATCGTCGGGCGCTGCACCGAGAGCGAATCCGGCGGCCGGATGATCGACGCAATACTGACCAACACCAT
GCTGCCCGCAATCAGCCGCGAGTTCCTTGCGCGGTTGATCGACGGCGGCGCTATCGGGCAGGTTCGCGTG
AGCGTGGAGCAAGGCGATTTCGCGTATTCGTTCGACGCGTGCGCGCCGGCTGTCACTGCGCCTGCCGATG
CGCTGGCATAG
 Primer design