SecReT6
Protein ID: 307726210
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4196
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]766839..767864 [-]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDE1TEA3
KEGG IDbgf:BC1003_4196
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-103, Aligned region: 21..325
Protein Sequence: 341 a.a.     [Download]
>gi|307726210|ref|YP_003909423.1| type VI secretion protein, VC_A0111 family [Burkholderia sp. CCGE1003]
MVRHTRQASDSLALEAALSERPFDFEFFEAMRRLECAYPDHPRFGHSTKPADDPVRLAHAATLEFAPRGI
ERFERGAPGSPGTPGTLYGLFFGLFGPNGPLPLHLTEHALERQRNAKDTSLVAFADIFHHRMLSLFYRAW
ADAQPTVQLDRPNEDRFRTYVGALIGMAAPQLAARDALPDQYKRFFAGRLVPQARNAEGLRGFLAHYFGV
PVAVLEFMTGWMQLPRDTHLRMGIAVASLGRDATLGAHVRGAQQRFRLRIGPLPLGEFKRFLPGGDALAE
LVAAVKLYVGGEKRWDVQIVLKKEEVPATHLGQMGRMGFSTWMGHYRKPVDADEVVLTPVD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c767864-766839 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGTCCGCCACACCCGGCAAGCGTCCGATTCTTTAGCGCTCGAGGCCGCGCTGAGCGAGCGGCCATTCG
ACTTCGAGTTTTTCGAGGCGATGCGCCGGCTCGAATGCGCGTACCCGGACCATCCGCGCTTCGGGCATTC
GACCAAGCCTGCCGACGATCCCGTGCGGCTTGCGCATGCGGCGACGCTCGAGTTCGCGCCGCGCGGCATC
GAGCGCTTCGAGCGCGGGGCGCCGGGCTCGCCAGGCACGCCAGGCACGCTGTACGGGCTGTTTTTCGGGC
TGTTCGGACCGAACGGTCCGTTGCCGTTGCATCTGACCGAGCATGCGCTCGAGCGTCAGCGCAACGCGAA
AGACACGTCACTCGTGGCGTTTGCCGACATCTTTCATCACCGGATGCTGAGCCTTTTCTACCGCGCGTGG
GCCGATGCGCAGCCCACGGTTCAGCTCGATCGTCCCAACGAAGACCGCTTTCGCACGTATGTCGGCGCTC
TGATTGGAATGGCCGCGCCGCAACTCGCGGCACGCGACGCGCTGCCGGATCAGTACAAGCGTTTTTTCGC
CGGCCGGCTGGTGCCGCAGGCCCGCAATGCGGAGGGGCTCAGGGGCTTTCTTGCGCACTACTTCGGCGTG
CCGGTGGCGGTGCTCGAATTCATGACGGGCTGGATGCAGTTGCCGCGCGACACCCATCTGCGAATGGGCA
TTGCGGTCGCGTCATTGGGTCGCGACGCGACGCTCGGCGCCCATGTGCGCGGCGCGCAGCAACGCTTTCG
CTTGCGGATCGGCCCGCTGCCGCTTGGCGAGTTCAAGCGGTTTTTGCCGGGCGGCGACGCGCTCGCCGAA
CTGGTGGCTGCGGTAAAGCTCTACGTGGGCGGTGAAAAGCGCTGGGACGTGCAGATCGTGCTCAAGAAAG
AAGAGGTGCCCGCGACCCATCTCGGCCAGATGGGCCGCATGGGGTTCAGCACATGGATGGGCCATTACCG
CAAGCCCGTGGATGCGGATGAGGTCGTGCTGACGCCTGTCGACTGA
 Primer design