SecReT6
Protein ID: 307726211
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4197
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]767828..769735 [-]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDE1TEA4
KEGG IDbgf:BC1003_4197
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-216, Aligned region: 5..635
Protein Sequence: 635 a.a.     [Download]
>gi|307726211|ref|YP_003909424.1| type VI secretion protein, VC_A0110 family [Burkholderia sp. CCGE1003]
MDPRLLSYYNRELQHVREMGAEFASAYPKIAGRLGMEGFECADPYVERLLEGFAFLAARVQLKLDAQYPV
FTQHLLEMIYPHYLLPIPSMAVVQMHPDGTQDLPVAGHAVARHTVLRSLKGFGDRTACEYRTAHEVTLWP
LELAEARYFDTPAALAAAGLVPPPGREVRAGLRLRFSTLSGAQTNMLALDNLPVHLAGADELPNVIYEQM
LANGAGYTVRVRGAQEGQFVSEHHHAAALRATGFDEHEAMLPYGDRSFSGYRLLQEYFACPERFRFVEFT
GLRSALTRAQGNEFEIVVWLGRAVARLHHALDAGNFRLFCTPAVNLFEQRADRIHLQQGKTEYHVIGDRT
RPMDFEVHSVLDVQGYGDSQEPQQSFLPFYGGTSRTWHDAQSAFYTLRREPRLLSGRQLQNGARSSYVGS
ETFIALVDANDAPYSSTLRQLGLRVLCTNRDLPLHMPVGKSYTDFTLDTDAPVTSIRCIAGPTRPRAPTA
TGETAWRLISHLQLNYLSLFEDSGDADRDGEQNAAALREMLGLYRDEFDAAARRKIEGIKRVAARPATRR
IPVPGPITYGRGLEITLTCSDAAFEGSSAFLLASVLQHFFARYVSLNSFTETVLRTFERNEVARWSATPG
KRPIL
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c769735-767828 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGACCCACGTCTTCTCAGTTACTACAACCGCGAACTGCAGCATGTTCGCGAGATGGGCGCGGAGTTCG
CCAGCGCCTATCCGAAGATCGCGGGGCGCCTCGGCATGGAAGGCTTCGAATGTGCCGATCCCTATGTGGA
GCGGCTGCTGGAAGGCTTTGCGTTTCTCGCCGCTCGGGTGCAATTGAAGCTCGATGCGCAGTACCCGGTG
TTCACCCAGCATTTGCTGGAAATGATTTATCCGCACTATCTGCTGCCGATTCCGTCGATGGCGGTGGTGC
AAATGCATCCGGACGGCACCCAGGATTTGCCCGTTGCCGGTCACGCGGTCGCGCGGCACACGGTGCTGCG
CAGCCTGAAGGGTTTCGGCGACCGCACAGCGTGCGAGTATCGAACCGCGCACGAAGTCACGCTGTGGCCG
CTCGAACTTGCCGAGGCGCGCTACTTCGACACGCCGGCCGCGCTTGCCGCTGCCGGTCTCGTGCCGCCGC
CGGGGCGGGAGGTTCGCGCGGGGTTGCGGCTGCGCTTCTCCACCTTGTCCGGCGCGCAGACCAACATGCT
GGCGCTCGACAACCTGCCGGTTCACCTTGCCGGCGCGGACGAACTGCCCAACGTCATCTACGAGCAGATG
CTCGCAAACGGGGCGGGCTATACGGTCCGCGTGCGGGGCGCGCAGGAAGGCCAATTCGTCAGCGAGCATC
ATCACGCGGCGGCGCTGCGCGCGACGGGCTTCGACGAACACGAGGCGATGCTGCCATACGGCGACCGTTC
GTTTAGCGGCTATCGTCTGCTGCAGGAATATTTCGCGTGCCCGGAGCGCTTTCGTTTTGTCGAGTTTACG
GGCCTGCGCTCCGCGCTCACACGGGCGCAGGGCAATGAGTTCGAGATCGTGGTGTGGCTCGGTCGCGCTG
TGGCCAGGCTGCATCACGCGCTCGACGCGGGCAACTTCAGGCTGTTCTGCACGCCGGCGGTCAACCTGTT
CGAGCAGCGCGCCGACCGGATCCATCTGCAACAGGGCAAGACCGAGTATCACGTGATAGGCGATCGCACG
CGGCCGATGGATTTCGAGGTGCACAGCGTGCTCGACGTGCAGGGCTATGGCGACAGCCAGGAACCGCAGC
AAAGCTTTTTGCCGTTCTATGGCGGCACGTCGCGCACCTGGCATGACGCGCAGTCGGCCTTCTATACGTT
GCGCCGCGAGCCGCGTCTTCTTTCGGGCAGGCAATTGCAGAACGGCGCACGCTCCAGCTATGTGGGCAGC
GAGACCTTTATTGCACTCGTCGACGCCAACGACGCACCGTACTCCAGCACGCTGCGTCAGCTCGGCTTGA
GGGTGTTGTGCACCAACCGCGATCTGCCATTGCACATGCCGGTCGGCAAGTCGTACACCGATTTCACGCT
GGACACCGACGCACCGGTTACATCGATTCGCTGCATCGCCGGTCCGACCCGGCCACGCGCGCCGACCGCG
ACCGGCGAGACCGCATGGCGGCTGATCAGTCACCTGCAGCTCAATTACCTGTCGCTCTTCGAGGACAGTG
GCGACGCCGATCGCGACGGCGAGCAGAATGCCGCGGCATTGCGCGAAATGCTCGGCCTCTATCGCGACGA
GTTCGATGCGGCGGCACGCCGAAAGATCGAGGGCATCAAGCGGGTCGCCGCCAGGCCCGCCACGCGACGA
ATACCCGTGCCCGGACCGATCACGTACGGACGCGGCCTTGAAATCACACTGACCTGTAGCGACGCCGCCT
TCGAGGGCAGCAGCGCGTTTCTGCTCGCGTCGGTGCTTCAGCATTTTTTTGCGCGCTACGTCTCGCTGAA
TTCGTTCACCGAGACTGTTTTGCGCACCTTCGAACGTAACGAGGTAGCCCGATGGTCCGCCACACCCGGC
AAGCGTCCGATTCTTTAG
 Primer design