SecReT6
Protein ID: 307726212
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4198
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]769741..770244 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDE1TEA5
KEGG IDbgf:BC1003_4198
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.00E-21, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|307726212|ref|YP_003909425.1| type VI secretion system lysozyme-related protein [Burkholderia sp. CCGE1003]
MAELTPQERLQPSLLDRLTDMAPGEPDESREQRVITAARLREYVTRDIAALLNCTRQWDSDSLPGLDHVA
NSVLNFGIPDLAGAPLSGIDAGVLQERIRTALIDFEPRLIAETVQVAVNIDDAVMNARSLSFRIESQMWA
QPMPLALYLHTDVDLETGEFRVSQHFG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c770244-769741 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGCGGAGTTAACCCCTCAGGAACGCTTGCAGCCCTCGTTGCTCGACCGGCTCACCGACATGGCGCCCG
GCGAGCCCGACGAGAGCCGCGAGCAGCGGGTCATCACGGCGGCTCGGCTGCGCGAGTACGTGACACGTGA
CATTGCCGCGCTCCTGAACTGCACGCGGCAGTGGGACAGCGACAGTCTTCCCGGGCTGGATCACGTCGCC
AACTCCGTCCTGAACTTCGGTATCCCGGACCTGGCGGGCGCGCCGTTGTCCGGCATCGACGCAGGCGTGT
TGCAGGAGCGTATCCGCACAGCGCTCATCGACTTCGAGCCGCGCCTGATTGCGGAAACGGTGCAAGTGGC
CGTGAACATCGACGACGCGGTGATGAACGCACGCTCGCTGAGTTTTCGTATCGAGTCGCAGATGTGGGCG
CAACCCATGCCGCTTGCGCTCTATCTGCATACCGACGTCGATCTCGAGACTGGTGAATTCCGGGTCTCGC
AACATTTCGGCTGA
 Primer design