SecReT6
Protein ID: 307726213
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4199
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]770299..770802 [-]
Producthypothetical protein
NoteTssD
UniProt IDE1TEA6
KEGG IDbgf:BC1003_4199
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-34, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|307726213|ref|YP_003909426.1| hypothetical protein BC1003_4199 [Burkholderia sp. CCGE1003]
MAFDMHLKFGSGSVTIQGASNHSKHKNEVPIIAWSWGVSNTGNLHTGAGYASGGKANIQDITITKYVDSC
SNAILNACCTGARLETANLYVTNATGQQTDFLTIELSEGVLITSVATGGSGGDERLTENITLHFGKFKYS
FQPQDDEGKASGGTKDFTFDIQQVAKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c770802-770299 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGCATTCGATATGCACCTGAAATTCGGCTCCGGTTCGGTCACGATCCAGGGCGCGTCCAATCATTCGA
AGCACAAGAACGAGGTGCCGATCATCGCGTGGTCGTGGGGCGTCAGCAACACCGGCAACCTGCACACAGG
CGCGGGCTACGCGTCGGGCGGCAAGGCAAACATCCAGGACATTACCATCACCAAGTACGTCGACAGTTGC
TCGAACGCGATCCTCAACGCCTGCTGCACGGGCGCGCGACTTGAAACCGCCAATCTGTACGTGACCAATG
CGACCGGTCAGCAAACGGACTTCCTTACGATCGAACTGAGCGAAGGCGTGCTGATCACGTCGGTCGCGAC
CGGAGGCAGCGGTGGCGACGAGCGTCTGACCGAAAACATCACGCTGCACTTCGGCAAGTTCAAGTATTCG
TTCCAGCCCCAGGACGACGAAGGCAAGGCAAGCGGCGGCACGAAGGACTTCACGTTCGACATCCAGCAGG
TCGCGAAGCAGTAA
 Primer design