SecReT6
Protein ID: 307726214
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4200
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]770913..772406 [-]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDE1TEA7
KEGG IDbgf:BC1003_4200
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-189, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.0066, Aligned region: 19..59
Protein Sequence: 497 a.a.     [Download]
>gi|307726214|ref|YP_003909427.1| type VI secretion protein, EvpB/VC_A0108 family [Burkholderia sp. CCGE1003]
MESQNQLEAAAQGTLSPTSDFAALLNKEFRPKNERAREEVEAAVRTLAEQVLQDSNIVSDDVTQTINAYV
AEIDRKITEQLNRIMHHEQFQKLEGAWRGLHHLVTNSETDPMLKIRVLNVSKKELGKNLKRFKGVAWDQS
PVFKRIYEEEYGQLGGEPYGCLIGDYYFDHSPQDIEMLRGISQIAAAAHAPFISAADSSLLGMENWSELA
NPRDLSMIFTTPDYAGWRSLREMDDARYLALTMPRTLARLPYGAKTDPVEEFDFEEDTEGADSSKYTWQN
AAYSMAVNINRSFKLYGWCTRIRGVESGGAVENLPVHAFPSDDGGVDIKCPTEIAITDRRSAELDKMGLM
PLVYRKNSDVAAFIGAQSVAKPEEYDDPSATANSNLSARLPYMFACCRFAHYLKCIVRDKIGSFSTREQM
ESWLSNWVMNYVDGDPVNSSEETKARKPLAAAQVVVEEVEGNPGYYTSKFFLKPHYQLEGLTVSLRLVSR
LPSALAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c772406-770913 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGAAAGCCAGAACCAGTTGGAAGCGGCCGCCCAAGGCACGCTGAGCCCCACGAGCGACTTCGCCGCGC
TGCTGAACAAGGAGTTTCGCCCGAAGAACGAGCGCGCGAGGGAAGAGGTCGAGGCGGCCGTGCGCACGCT
CGCCGAGCAGGTGCTGCAAGATTCGAACATCGTCTCCGACGACGTGACGCAAACCATCAATGCGTATGTC
GCGGAGATCGACCGCAAGATCACCGAGCAGTTGAATCGCATCATGCATCACGAGCAATTCCAGAAACTGG
AGGGCGCATGGCGCGGCCTGCATCATCTGGTCACGAATTCGGAGACCGATCCGATGCTCAAGATTCGCGT
GCTGAATGTGTCGAAGAAGGAGTTGGGGAAGAACCTCAAGCGCTTTAAAGGCGTTGCATGGGACCAGAGC
CCGGTGTTCAAGCGCATCTACGAAGAGGAGTATGGTCAGCTCGGCGGCGAACCGTACGGCTGCCTGATCG
GCGATTATTACTTCGATCATAGCCCTCAGGATATCGAAATGTTGCGCGGCATCTCGCAGATTGCCGCCGC
GGCCCACGCACCGTTTATCTCCGCCGCCGATTCGAGCCTGCTCGGCATGGAAAACTGGAGCGAGCTTGCC
AACCCGCGTGACCTGTCGATGATCTTCACGACGCCGGACTACGCCGGCTGGCGCTCGCTGCGCGAAATGG
ACGACGCGCGTTACCTGGCGCTGACGATGCCCCGCACGCTTGCGCGACTGCCGTACGGCGCGAAGACCGA
CCCCGTCGAGGAGTTCGATTTCGAAGAAGACACGGAGGGCGCTGATTCGTCGAAATACACATGGCAGAAC
GCGGCTTATTCGATGGCGGTGAACATCAATCGCTCGTTCAAGCTGTATGGCTGGTGCACGCGCATTCGCG
GCGTGGAGTCGGGCGGCGCGGTCGAGAACCTGCCGGTTCACGCTTTCCCGAGCGACGACGGCGGCGTAGA
CATAAAGTGCCCCACTGAAATTGCGATCACCGACAGGCGCTCGGCGGAACTCGACAAAATGGGTCTGATG
CCGCTCGTGTACCGCAAGAACTCGGACGTTGCCGCGTTCATCGGCGCGCAGTCGGTGGCAAAGCCGGAAG
AGTACGACGATCCGTCGGCGACCGCGAATTCGAATCTCTCGGCGCGGTTGCCGTACATGTTCGCGTGCTG
CCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAGCACGCGTGAGCAGATG
GAGAGCTGGTTGTCGAACTGGGTGATGAACTATGTCGACGGCGATCCGGTGAACTCGAGCGAAGAAACCA
AGGCGCGCAAGCCGCTCGCCGCGGCACAGGTGGTAGTCGAGGAAGTCGAGGGCAACCCTGGCTACTACAC
GTCCAAGTTCTTCCTGAAACCGCATTACCAGCTTGAAGGCCTGACGGTGTCGCTGCGGCTCGTATCGCGC
CTGCCTTCCGCACTCGCCGCGTAG
 Primer design