SecReT6
Protein ID: 307726215
SecReT6 ID498
T6SS typei3
Gene symbol-
Locus tagBC1003_4201
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]772415..772936 [-]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDE1TEA8
KEGG IDbgf:BC1003_4201
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.00E-60, Aligned region: 11..163
Protein Sequence: 173 a.a.     [Download]
>gi|307726215|ref|YP_003909428.1| type VI secretion protein, VC_A0107 family [Burkholderia sp. CCGE1003]
MATRQSSQKFIARNRAPRVQIEYDVELYGAQKKVQIPFVMGVMSDLSGANSGDLPPIEERKALEVDVDNF
DSRMQSMKPRVSFNVPNTLTGEGNLEVDMTFESMDDFSPAAVARKVDALARLLQARTQLANLGTYLDGKA
GAEKLIAEALKDPALLQSLSAAPKPADTEPGQE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c772936-772415 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGCAACGAGACAGAGCAGTCAAAAATTCATTGCGCGAAATCGTGCGCCGCGCGTACAGATCGAATATG
ACGTCGAGCTGTACGGTGCGCAAAAGAAAGTGCAGATACCGTTTGTAATGGGCGTGATGTCGGATCTGTC
CGGCGCAAACAGCGGCGATCTTCCGCCAATAGAGGAGCGCAAGGCATTGGAGGTGGATGTCGATAACTTC
GACAGCCGCATGCAATCGATGAAGCCGCGAGTGAGCTTCAACGTTCCCAACACATTGACGGGCGAAGGCA
ATCTCGAAGTGGACATGACGTTCGAAAGCATGGACGACTTTTCGCCCGCCGCGGTCGCGCGCAAGGTTGA
TGCGCTCGCCCGGCTGCTCCAGGCACGCACGCAACTGGCGAATCTCGGTACTTATCTCGACGGCAAGGCC
GGCGCGGAGAAACTCATTGCCGAGGCGCTGAAGGACCCGGCGCTGCTGCAATCGCTAAGCGCCGCGCCAA
AGCCTGCTGACACCGAACCCGGACAGGAGTGA
 Primer design