SecReT6
Protein ID: 307727722
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5731
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2516822..2517601 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDE1TGH8
KEGG IDbgf:BC1003_5731
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.50E-57, Aligned region: 29..230
Protein Sequence: 259 a.a.     [Download]
>gi|307727722|ref|YP_003910935.1| type IV / VI secretion system protein, DotU family [Burkholderia sp. CCGE1003]
MSYAPSLFGGSTPAATPLPASEPSYQVRSLLDLLYDGFFMLFLLKNGREPGEAHEFSQRIQQFLGDFERG
AKKLNASAEDVYASKFAFCAAIDESVLSSTFRIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAAR
LQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWQLPDQVAHRLKREVPLWS
IGAVFALVGLLAYLGLNTYLRDQTLRTLAPYSQVVKLGPQSATLTISLP
 
Nucleotide Sequence: 780 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c2517601-2516822 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAGCTACGCGCCTTCACTATTCGGCGGCAGCACGCCTGCCGCGACGCCGTTGCCGGCAAGCGAACCGA
GCTACCAGGTCCGCTCGCTGCTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGTTGAAGAACGG
CCGCGAGCCCGGCGAGGCGCACGAGTTCAGTCAGCGCATTCAGCAGTTTCTCGGCGACTTCGAGCGCGGC
GCGAAGAAGCTCAACGCATCCGCGGAAGACGTGTATGCGTCGAAGTTTGCATTCTGCGCGGCGATAGACG
AGTCGGTGTTGTCGTCCACCTTCAGGATTCGCGCCGACTGGGAGCGCCGGCCACTGCAACTCGTGCTGTT
CGGCGAGCAACTGGCGGGGGAAAAATTCTTCCAGTATCTCGAGGAATGCCGCGCACAAGGCGCGGCGCGC
TTGCAGTCGCTCGAGGTGTTCCACATGTGCCTGCTGCTCGGCTTTCAGGGCAAGTATCTGCTGGAAGGGC
CGGAGAAGCTTGCGTATCTGACCGCGCGCCTCGGCGACGAAATCGCGCACATGAAGGGCAAGCGGGCGCC
GTTCGCGCCGCACTGGCAACTGCCCGACCAGGTCGCGCACCGTCTCAAGCGTGAAGTGCCGTTGTGGTCG
ATCGGCGCAGTGTTCGCCCTGGTCGGACTGCTCGCGTATCTGGGCTTGAACACCTATCTGCGCGATCAGA
CCTTGCGCACGCTGGCGCCGTATTCGCAAGTGGTCAAGCTGGGGCCGCAGTCGGCCACGCTGACCATCTC
GCTGCCGTAG
 Primer design