SecReT6
Protein ID: 307727723
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5732
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2517598..2518995 [-]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDE1TGH9
KEGG IDbgf:BC1003_5732
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-132, Aligned region: 36..463
Protein Sequence: 465 a.a.     [Download]
>gi|307727723|ref|YP_003910936.1| type VI secretion protein, VC_A0114 family [Burkholderia sp. CCGE1003]
MGLFGARSTLNPYNRFEMSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSARFDRD
ALGSNVLRVSELSLVFPDGALYSAPQADDLPPPIALDTLPDGINEFTFYLALHPLRETGANYSQDSNAGF
VARYVSEQAPVADHFTDAAEADITFLKTSVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLA
IDASPVLHQRLRQLIDALQAKVSALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLYQHSALH
PERLFQELLRLAGQLMTFSKGYALSDLPAYRHDDPGPGFARLDMILRDLLETVISTRYFAIALEEVRPSF
HAGRLDSGKIDDKTMFYIAVSADMPTAELVEAVPARFKVGAPDDVDKLVLSAMPGVRLVYTPQVPPAIPV
RPGACYFSFEPRGGLYERMLQAQSAMIYAPSGINDLQLELIAVTS
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c2518995-2517598 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGGCTTATTCGGGGCGCGCAGCACGCTGAACCCATATAACAGGTTTGAGATGAGTTATTCCGCAAAAG
TGCTCTGGGGGGAAGGCCTGTTTCTCAGGCCGCAGCATTTTCAGCGTCAGGACGCCTATCACGAGGCGCG
CCTCTTCGAGTCGATCCAGGCGATCCAACCGTACAACTGGGGCGTGCGCTCCGCGCGTTTCGACCGCGAC
GCGCTCGGCAGCAATGTGCTGCGCGTGAGCGAACTGTCGCTGGTGTTCCCCGACGGCGCGCTCTACTCCG
CACCGCAAGCGGACGACCTGCCGCCGCCCATCGCACTCGACACGTTGCCCGACGGCATCAACGAATTCAC
GTTCTATCTCGCGCTGCATCCGCTGCGCGAGACAGGCGCGAACTATTCGCAGGACAGCAACGCGGGCTTC
GTTGCGCGGTACGTGAGCGAGCAGGCTCCGGTCGCCGACCATTTCACGGACGCGGCGGAAGCGGACATCA
CCTTCCTCAAGACCAGCGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACCAGTTGCTGTCGGTGCCGCT
CGTGCGCGTGCGCCGCACTGCCACCTCGGGCTTCGAGATCGACGACAGTTTCGTGCCGCCCTGCCTCGCC
ATCGACGCCTCGCCGGTCCTGCATCAGCGGCTGCGCCAACTGATCGACGCGCTGCAGGCAAAGGTCAGCG
CGCTGTACGGCTTTCACCGCGAGCCGACCAAGAACATCATCGAGTTCCGTTCGGGCGACATTGCGTCGTT
CTGGCTGCTGCACACGGCGAGCGCGGCGTTTGCAGCGCTTGCGCATCTTTACCAGCATTCGGCGCTGCAT
CCGGAGCGGCTCTTTCAGGAACTGCTGCGCCTCGCGGGCCAGTTGATGACGTTCTCCAAGGGCTATGCGC
TCTCCGACCTGCCGGCTTACCGGCACGACGATCCTGGTCCCGGCTTTGCGCGGCTCGACATGATTCTGCG
CGACTTGCTCGAGACCGTCATCTCCACGCGCTACTTTGCGATCGCGCTTGAAGAAGTGCGTCCATCGTTT
CATGCGGGGCGGCTCGACTCCGGCAAGATCGACGACAAGACGATGTTCTACATTGCCGTGTCCGCCGACA
TGCCCACCGCCGAACTGGTCGAAGCAGTACCGGCACGCTTCAAGGTCGGCGCGCCAGACGACGTCGACAA
GCTGGTGCTCTCGGCCATGCCGGGCGTGCGGCTCGTGTACACGCCGCAAGTGCCGCCCGCCATTCCGGTG
CGGCCGGGCGCCTGCTACTTCTCGTTCGAGCCGCGCGGCGGGCTGTACGAGCGCATGCTGCAAGCGCAGT
CGGCCATGATCTATGCGCCCTCGGGCATCAACGATCTTCAACTTGAACTGATCGCGGTCACATCATGA
 Primer design