SecReT6
Protein ID: 307727724
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5733
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2519053..2519757 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDE1TGI0
KEGG IDbgf:BC1003_5733
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.50E-36, Aligned region: 45..206
Protein Sequence: 234 a.a.     [Download]
>gi|307727724|ref|YP_003910937.1| type VI secretion lipoprotein, VC_A0113 family [Burkholderia sp. CCGE1003]
MSGGHFAEIISLSMFRRGTAASRSMDMNSRLVRHASLLITQAAACALLGGCAAGVSVLGAAANAALQASG
LGKPELPDAQKPPRNVPVTLYAAPNLNAANDKRPLALVVRLYILKDPTSFQQAPFDAFTDAAKEKTTLGG
DLLGVREVTLIPGQRYVVTEKVSREAQAFGIVALFRDPAMQRWKFAFDPAKSEKSGIMVGLHNCAMTVTN
GTVIPPEQGLPAQPLNMLSSVSCG
 
Nucleotide Sequence: 705 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c2519757-2519053 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAGTGGCGGACATTTCGCTGAAATCATTTCGTTATCAATGTTTAGACGGGGGACGGCGGCCAGCCGGT
CGATGGATATGAATTCGCGCCTTGTTCGCCATGCATCGCTATTGATTACCCAGGCTGCCGCGTGTGCGCT
TCTGGGCGGTTGCGCCGCCGGCGTCTCCGTGCTCGGAGCCGCCGCCAACGCGGCTTTGCAGGCAAGCGGC
CTTGGCAAGCCCGAATTGCCGGACGCGCAGAAACCGCCGCGCAACGTGCCTGTCACCTTATACGCGGCGC
CCAATCTGAATGCCGCGAATGACAAGCGGCCATTGGCTCTGGTGGTGCGACTTTACATATTGAAAGACCC
GACTTCATTCCAGCAGGCTCCATTCGACGCATTTACGGACGCGGCGAAGGAAAAGACCACACTCGGCGGC
GATCTGCTTGGCGTGCGTGAAGTCACGCTAATCCCGGGCCAGCGTTACGTTGTGACCGAAAAAGTGTCGC
GTGAAGCGCAGGCATTCGGTATCGTCGCGCTATTCCGCGATCCCGCCATGCAGCGTTGGAAATTCGCCTT
CGACCCGGCAAAGTCGGAGAAATCCGGCATAATGGTCGGCCTGCATAACTGTGCAATGACCGTCACCAAC
GGTACCGTGATCCCGCCGGAACAGGGATTGCCCGCCCAGCCGCTCAATATGCTTTCTTCGGTTAGCTGCG
GTTAA
 Primer design