SecReT6
Protein ID: 307727726
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5735
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2520778..2521326 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDE1TGI2
KEGG IDbgf:BC1003_5735
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-58, Aligned region: 11..164
Protein Sequence: 182 a.a.     [Download]
>gi|307727726|ref|YP_003910939.1| type VI secretion protein, VC_A0107 family [Burkholderia sp. CCGE1003]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSETGGKFAVDLRFKSMADFNPDEVVAQIEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLNNTQQLQALAKDQGNAADRDGGAPDHDKQGE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2520778-2521326 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGCGAAGAAAGAAAGCATACAAAAACGCTTGCAGAAAGTGCGGCCGCCCCGCGTGCAGCTCACCTATG
AGGTCGAGCGCGGCGATGCGATCGAAGTGAAGGAACTGCCGTTCGTGGTCGGCGTGGTGGCCGATCTCGC
CGGGCAGTCCGAAGTCGAGCAGCCCAAGCTGCGCGACCGCAAGTTCGTCAACATCGATCGCGACAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCGGCCTTTCAGGTGGAAAACCGTCTGAGCGAAACCGGCG
GCAAATTCGCGGTCGATCTGCGGTTCAAGTCGATGGCCGATTTCAATCCGGACGAGGTGGTCGCGCAAAT
CGAACCGCTGCGCCGTCTGCTTGAAGCTCGCTCGAAGCTCGCAGATTTGCGCAACAAGCTTGCCGGCAAT
GACAAGCTCGAAGACCTGCTTTCCGAAGTGCTCAACAACACGCAGCAGTTGCAGGCACTGGCAAAAGACC
AGGGCAATGCGGCGGACCGGGACGGCGGCGCGCCGGATCACGACAAGCAAGGCGAATAA
 Primer design