SecReT6
Protein ID: 307727727
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5736
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2521341..2522831 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDE1TGI3
KEGG IDbgf:BC1003_5736
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.40E-190, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|307727727|ref|YP_003910940.1| type VI secretion protein, EvpB/VC_A0108 family [Burkholderia sp. CCGE1003]
MNQQTAAAQLATAQSGTESTLLDEIVEKSRVAKSDSEHARAKDLIGELVREVLDGTVVVSDNLSATIDAR
VAELDRLISAQLSAVMHAPEFQRMESTWRGLDYLCKESNTGATVKIKALHAPKRDLVRDFKTAIEFDQSA
LFKKIYEEEFGTFGGSPFGAIIGDFEVTRQPEDVYFIEQMSHVAAAAHAPFIASASPELLGLETFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGATAEGFNFVEDVDGTDHSKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
EVFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2521341-2522831 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAATCAGCAAACGGCGGCAGCCCAACTCGCCACCGCGCAAAGCGGTACGGAATCCACGCTGCTCGACG
AGATCGTCGAAAAGAGCCGCGTCGCGAAGTCCGATTCCGAACATGCGCGCGCGAAAGACCTGATCGGCGA
ACTCGTGCGCGAAGTGCTCGACGGCACAGTGGTGGTCTCGGACAACCTGTCGGCCACTATCGACGCGCGC
GTGGCCGAGCTCGACCGGCTCATTTCCGCGCAGTTGAGCGCGGTCATGCATGCGCCGGAGTTCCAGCGCA
TGGAAAGCACGTGGCGCGGGCTCGATTATTTGTGCAAGGAGAGCAACACCGGCGCGACGGTCAAGATCAA
GGCGCTGCATGCGCCCAAGCGCGACCTCGTGCGCGACTTCAAAACCGCCATCGAATTCGACCAGAGCGCG
CTCTTCAAGAAGATCTATGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGGGCGATCATCGGCG
ACTTCGAAGTCACCCGTCAGCCGGAAGACGTGTATTTCATCGAGCAGATGTCGCACGTCGCGGCAGCCGC
GCATGCACCCTTTATCGCATCGGCGTCGCCTGAATTGCTGGGCCTTGAAACGTTTGCCGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTATTCGACACGGTCGAATACGCAAAGTGGAAGTCGTTCCGCGACTCGGAAG
ATTCGCGTTATGTCGGCCTCACGCTGCCGCGTTTTCTCGGCCGCTTGCCGTTCAATCCGAAAGACGGTGC
GACCGCAGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACGGATCACAGCAAGTACCTCTGGTGTAAC
GCGGCATGGGCGTTCGCCGCGCGTCTTACCGCTGCATTCGACGACTTCGGCTGGTGTGCCGCAATTCGCG
GCGTGGAAGGCGGCGGCCTCGTCGAAGATCTGCCGACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTGAAATGCCCGACCGAAATCGCGATTACAGATCGCCGCGAGAAAGAGCTGAGCGACCTCGGCTTCATT
CCGCTCGTGCATTGCAAGAACTCCGACTACGCTGCGTTCTTCGCCGCGCAATCGGTGCAAAAACCGAAAA
AATACAGCACCGACAGCGCGAATGCGAACGCTGTTCTGTCTGCACAGCTGCAGTACATCTTCTCGGTGTC
GCGAGTCGCGCACTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTTGCATCGGCGCAGAACGTC
GAAGTATTCCTGAACCGCTGGATCTCGCAATACGTGCTGCTCGACGACAACGCGACGCAGGAACAGAAAG
CTCAGTTCCCGCTGCGCGAAGCCTCCATTCAGGTCTCGGAAATTCCGGGCAAGCCGGGCGCTTATCGCTC
CGTTGCGTTCCTGCGCCCGCATTTCCAGCTCGACGAACTGTCCATCTCGTTGCGGCTCGTCGCCGACCTG
CCGAAGCCGGCCAATTCATAA
 Primer design