SecReT6
Protein ID: 307727728
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5737
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2522905..2523408 [+]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDE1TGI4
KEGG IDbgf:BC1003_5737
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-44, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|307727728|ref|YP_003910941.1| type VI secretion system effector, Hcp1 family [Burkholderia sp. CCGE1003]
MKDIYLKFGNPAIKGESADKDHAGWIEIDSWSHSITQPRSATASTAGGHTSERCEHADMVFTKDIDVVSP
LIYQHASGGTTFDEVTIDFMRSDGEGNRIKYLEVKLKYVIISSVTPSVVGEGLPSEQFSLKYAAVQWKYT
QQKIGGNQGGNAQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2522905-2523408 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAAGGACATCTATTTAAAATTCGGCAATCCGGCGATCAAAGGCGAGTCCGCCGATAAAGATCACGCTG
GCTGGATCGAAATTGATTCGTGGAGCCACTCGATCACGCAGCCGCGTTCGGCAACGGCTTCTACCGCGGG
CGGTCACACCTCGGAGCGTTGTGAGCATGCCGACATGGTGTTCACAAAAGACATCGACGTGGTGAGCCCG
CTGATTTATCAGCACGCATCGGGCGGCACGACGTTCGACGAAGTCACGATCGACTTCATGCGTTCGGACG
GCGAAGGCAACCGTATCAAGTATCTGGAAGTCAAGCTGAAGTACGTGATCATTTCCAGCGTGACGCCGAG
CGTGGTCGGTGAAGGCCTGCCGAGCGAGCAGTTCTCGCTGAAGTACGCCGCTGTGCAGTGGAAGTACACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACGCGCAAGGCGCGTGGAGCCTGACGAAGAACGACAAGA
CGTACGCGGTGTAA
 Primer design