SecReT6
Protein ID: 307727729
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5738
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2523497..2523976 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDE1TGI5
KEGG IDbgf:BC1003_5738
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-22, Aligned region: 29..137
Protein Sequence: 159 a.a.     [Download]
>gi|307727729|ref|YP_003910942.1| type VI secretion system lysozyme-related protein [Burkholderia sp. CCGE1003]
MKRFEPSFLDKLFDDEPHLPASPAMRQLSLDELKSTVARDVEAILNTRIALTEHELAALPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVSVTLELNEQSTNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARAKL
 
Nucleotide Sequence: 480 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2523497-2523976 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAAACGCTTCGAGCCCAGCTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCTTCACCGG
CGATGCGGCAATTGTCGTTGGATGAACTGAAAAGCACTGTCGCGCGCGACGTCGAAGCGATCCTGAACAC
GCGAATCGCGCTCACGGAGCATGAACTCGCCGCTTTGCCGGAGTGTCAGCGCTCGGTGCTTACTTATGGT
TTGAACGACTTCGCGGGTTTGAGCCTCGCGAGTCACTATGACCGCACGTTCATTTGCAAATCGATTCAAC
AGGCGATCGCACGGCATGAGCCGCGCCTGCAGCAGGTATCGGTGACACTCGAACTGAACGAACAATCGAC
CAATGCGCTTTACTTCGCAATTCAGGCGCTGCTGGTCGTTCACCCGGCAGAAGAACCGGTCAGTTTCGAC
GCAATGTTGCAGCCTTCGACATTGCAATACTCGGTGACGCGTGCACGCGCGAAACTGTAG
 Primer design