SecReT6
Protein ID: 307727730
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5739
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2524086..2525924 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDE1TGI6
KEGG IDbgf:BC1003_5739
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-215, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|307727730|ref|YP_003910943.1| type VI secretion protein, VC_A0110 family [Burkholderia sp. CCGE1003]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLAISGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQLGTSAAASHLTEPVVIERGTELKSRPIRGVQCRFRTAYDVTLAPVRI
SEAKYTSVAMAPSATVLPGNATAIVSITFESTAAQLDLSALKVNTLRAHLHGEQSFIAALADCLFVNAMA
TYVEADRRGVWTQLRTSPLAQAGFDEHDALIDYPAKSHPAYRLLTEYFAFPEKFNFADFDLAAMTRAAGR
CQRLTLHVVLKEVRSDSHVARLLDALSAHHLRLFCTPVVNLFEQHAEPIRVNHQAVSYPVVAEARRAFAY
EVYSIDSVKLVRQQAHQESVTEFRPFYSLHHGEAARAGHYWFARRNDWVAQKSPGYETEISIVDIDFEPS
APQTDTLSLDLTCTNRDLPAGLAIGLEGGDLFVEGGALTGSIAMLRRPTPSVRFERGRAAHWRLISHLAL
NHVSLASSGLSALKEMLVLYDLRRTAVSARHIDGLVGIEQRAAVQWLPGKPFATFVRGIEIRLTIDEEHF
VGTSLASFVRVIDTFFGLYVHLNSFVQLVVVSKRTGEEILRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2524086-2525924 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAACTGTCGTTTCTGCGGCGCTATTCGCGCGATTTCGCGG
AGCGCTACCCGAAAATCGCGGCGCGCCTTGCGATATCCGGCGAGCACTGCGAGGACCCGCACGTCGAGCG
CATGATCGAGTCGTTCGCCTTGCTCGGCGCGCGCATCAACAAGAAGCTCGACGACGATTACCCCGAGTTC
ACCGAAGCACTGCTGGAAGTGCTCTATCCGCACTATCTGCGGCCGTTTCCATCGTGTTCGATTGCGCAAT
TGGGGACCTCGGCGGCGGCGAGCCATCTGACGGAACCGGTTGTCATCGAGCGCGGCACCGAACTCAAATC
GCGTCCTATTCGCGGTGTGCAGTGCCGTTTTCGTACCGCGTACGACGTGACGCTCGCGCCGGTGCGCATT
TCCGAGGCAAAGTACACGTCGGTAGCCATGGCGCCGAGCGCGACTGTATTGCCCGGCAATGCCACCGCGA
TCGTATCCATCACTTTCGAATCGACCGCGGCACAGCTCGATCTGTCCGCGTTGAAAGTGAATACCTTGCG
CGCGCATCTACACGGCGAGCAGTCGTTCATTGCGGCGCTTGCGGACTGTCTGTTCGTCAATGCAATGGCC
ACGTATGTGGAAGCCGACCGGCGCGGCGTGTGGACGCAGTTACGTACGTCACCGCTTGCGCAAGCGGGTT
TTGACGAGCACGACGCGCTGATCGACTACCCGGCCAAATCTCACCCCGCTTACCGGCTGCTCACCGAGTA
CTTTGCATTCCCGGAAAAATTCAATTTTGCGGACTTCGATCTGGCGGCCATGACGCGTGCGGCGGGCCGC
TGCCAGCGCCTCACGCTGCATGTCGTGCTGAAGGAAGTGCGCAGCGACTCGCACGTCGCGCGGCTTCTCG
ATGCGTTGTCCGCGCATCACTTGCGTCTTTTCTGCACGCCGGTGGTCAATCTGTTCGAGCAGCACGCTGA
ACCGATTCGCGTCAATCATCAGGCCGTTTCTTATCCCGTGGTGGCCGAAGCGCGTCGTGCATTCGCATAC
GAGGTGTATTCGATCGACTCGGTGAAGCTGGTCAGGCAGCAGGCGCATCAGGAATCCGTAACCGAGTTCC
GGCCGTTCTACTCGCTGCATCATGGCGAAGCGGCGCGCGCGGGGCACTACTGGTTCGCGAGGCGCAACGA
CTGGGTCGCGCAAAAGAGCCCCGGTTACGAGACGGAAATCTCCATTGTCGATATCGACTTCGAACCGTCC
GCGCCGCAGACCGATACGTTGAGCCTCGATTTGACCTGTACCAATCGCGATCTGCCTGCTGGCCTCGCAA
TAGGACTGGAGGGCGGCGACCTGTTTGTCGAAGGCGGAGCGCTGACCGGCAGCATCGCCATGCTGCGCCG
GCCTACGCCGAGCGTGCGCTTTGAGCGCGGACGCGCCGCGCACTGGCGGCTCATTTCTCATCTTGCGCTG
AATCACGTATCGCTCGCGAGCAGCGGTCTTTCCGCATTAAAAGAAATGCTGGTGCTCTACGATTTGCGGC
GCACGGCAGTGTCGGCGCGCCATATCGACGGACTGGTCGGCATCGAGCAGCGCGCGGCCGTGCAATGGCT
GCCGGGCAAACCGTTCGCCACGTTCGTGCGCGGCATTGAAATTCGCCTGACCATCGACGAAGAACATTTC
GTCGGTACGAGTCTCGCGTCGTTTGTGCGGGTGATCGATACATTCTTCGGGCTGTACGTGCATCTGAACA
GCTTTGTGCAACTGGTCGTCGTGTCGAAGCGCACCGGCGAGGAGATCTTGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG
 Primer design