SecReT6
Protein ID: 307727731
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5740
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2525888..2526982 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDE1TGI7
KEGG IDbgf:BC1003_5740
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-94, Aligned region: 18..345
Protein Sequence: 364 a.a.     [Download]
>gi|307727731|ref|YP_003910944.1| type VI secretion protein, VC_A0111 family [Burkholderia sp. CCGE1003]
MQTAQRRIDPGVVEQLLDEPHRFEFFQAVRVLEKWFAQQAPSATGRSGDIVAQRIAFRNSLSMSFPPSEI
HGAQSYDDEGTALKEKAQRTAALESGSLEKVDITPAFFGLLGGQGALPLHYTEQIIAREQIKRDRAAREF
FDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLALAGVADNDTRSSLQSGEGALFDEAIAGYALP
TRHRPVSAAYLQRTLSDYFRVPVRVEQFVGKWYNVPRDQLTVLGSVNATLGATALAGERVWQRDMRARLV
IGPLDKADYEAFLPGADRAIALERMLTLLAGVTLEYEVKLVLRREAVGPTLLSQGARLGWDAFLCTRDAD
RDRADARYELHVIH
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2525888-2526982 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCAGCTTCTCGACGAGCCGCACCGCTTTG
AATTCTTTCAGGCAGTGCGCGTGCTCGAGAAGTGGTTCGCACAACAGGCGCCATCGGCCACCGGGCGTTC
GGGCGATATCGTCGCGCAGCGCATTGCGTTTCGCAATTCGCTTTCGATGTCGTTTCCACCGAGTGAGATT
CACGGCGCGCAATCTTACGACGACGAAGGCACCGCGCTAAAAGAAAAGGCGCAACGTACTGCGGCGCTGG
AAAGCGGCTCGCTCGAAAAGGTGGACATCACACCGGCGTTTTTCGGTTTGCTCGGCGGGCAGGGCGCATT
GCCGCTGCACTACACCGAACAGATCATCGCGCGCGAGCAGATCAAGCGTGATCGCGCCGCACGCGAGTTC
TTCGATGTGTTTTCGAATCGGGCCACCGCGCTCTTTTATGCGGCGTGGAAGAAGTACCGTCTGCCCTTTC
ATTATGAACTGGACCGCGACGAACGCTATTTGCCGCTGCTGCTTGCGCTTGCCGGCGTGGCCGACAACGA
CACGCGGAGCAGCCTGCAAAGCGGCGAAGGCGCGCTATTCGACGAAGCCATTGCGGGTTACGCACTACCG
ACACGGCACAGGCCCGTGTCCGCCGCGTACCTGCAACGCACACTGTCGGACTATTTCAGGGTTCCAGTGC
GTGTCGAACAGTTTGTCGGCAAGTGGTACAACGTCCCGCGCGATCAATTGACCGTGCTCGGCAGCGTCAA
CGCGACACTCGGCGCGACGGCGCTGGCGGGCGAGCGCGTCTGGCAGCGCGACATGCGGGCGCGGCTCGTG
ATCGGCCCGCTCGACAAGGCCGACTACGAGGCCTTCCTGCCGGGCGCGGATCGTGCCATTGCGCTCGAAC
GGATGCTGACCCTGCTCGCGGGCGTCACGCTCGAATATGAAGTGAAGCTGGTACTGCGGCGTGAGGCAGT
AGGGCCGACGCTTTTGAGCCAGGGCGCACGCCTTGGCTGGGACGCCTTTCTTTGTACGCGCGACGCAGAC
CGCGACCGCGCGGACGCGCGCTACGAGCTGCACGTGATTCACTGA
 Primer design