SecReT6
Protein ID: 307727732
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5741
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2527016..2529691 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE1TGI8
KEGG IDbgf:BC1003_5741
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 232..327
AAA_2 [PF07724], Evalue: 2.00E-44, Aligned region: 621..789
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 233..346
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 626..743
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 625..746
ClpB_D2-small [PF10431], Evalue: 2.60E-12, Aligned region: 796..872
Clp_N [PF02861], Evalue: 2.60E-10, Aligned region: 28..74
Clp_N [PF02861], Evalue: 2.60E-10, Aligned region: 114..132
AAA_16 [PF13191], Evalue: 1.30E-06, Aligned region: 48..77
AAA_16 [PF13191], Evalue: 1.30E-06, Aligned region: 210..258
AAA_16 [PF13191], Evalue: 1.30E-06, Aligned region: 277..311
AAA_16 [PF13191], Evalue: 1.30E-06, Aligned region: 596..646
AAA_16 [PF13191], Evalue: 1.30E-06, Aligned region: 692..713
AAA_16 [PF13191], Evalue: 1.30E-06, Aligned region: 791..820
Sigma54_activat [PF00158], Evalue: 2.40E-06, Aligned region: 227..249
Sigma54_activat [PF00158], Evalue: 2.40E-06, Aligned region: 602..744
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 54..95
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 233..319
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 357..403
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 622..646
AAA_22 [PF13401], Evalue: 2.90E-06, Aligned region: 687..719
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 227..255
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 625..643
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 799..836
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 234..295
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 625..661
AAA_17 [PF13207], Evalue: 0.00023, Aligned region: 808..817
AAA_29 [PF13555], Evalue: 0.00025, Aligned region: 224..249
AAA_29 [PF13555], Evalue: 0.00025, Aligned region: 621..651
NACHT [PF05729], Evalue: 0.00051, Aligned region: 233..260
NACHT [PF05729], Evalue: 0.00051, Aligned region: 382..488
NACHT [PF05729], Evalue: 0.00051, Aligned region: 626..646
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 0.00061, Aligned region: 622..647
Zeta_toxin [PF06414], Evalue: 0.00077, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 0.00077, Aligned region: 616..665
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 285..380
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 623..664
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 696..720
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 234..366
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 624..706
SRP54 [PF00448], Evalue: 0.0012, Aligned region: 233..254
SRP54 [PF00448], Evalue: 0.0012, Aligned region: 624..657
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 233..256
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 289..328
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 443..522
AAA_25 [PF13481], Evalue: 0.0029, Aligned region: 620..643
MobB [PF03205], Evalue: 0.006, Aligned region: 234..256
MobB [PF03205], Evalue: 0.006, Aligned region: 624..657
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0082, Aligned region: 626..647
Protein Sequence: 891 a.a.     [Download]
>gi|307727732|ref|YP_003910945.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1003]
MSTSLNTLIAKLNPTCRQAALQAANNCLARGHYEVDLEHLLLALLDEPASDLALVLRASSIDLHALRADI
ERELQRLKSGNTRTPVFSRHLIDLLEQAWLIASLDSQIGRIRSGHLLLALLSAPDLAQFAERMSPLWRDV
RVTDLKHKFDELTAGSCEVERSQDGQAATDRADDPATSASMPGTPSRTPALDTYTSNLTQRAREGKIDPV
IGREGEIRQTIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPAPLKGVALHVLDMGLLQAGAS
VKGEFENRLKSVIDEVKKSPHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYK
KYFEKDAALARRFQVVKIEEPSETLAAAMLRGMASLMEKHFNVRVLDDAITEAVRLSHRYISGRQLPDKA
ISVLDTACAKVALAHSSTPAAIDDTKKRLERIDAEIAALEREAASGAQHDERLAQLRELREEDLQHLAED
EARYDRERALVTEIVDLRAEIDAARVSSADAQQAEKAQQARETLALRVAELQALQGTQPMVPLQVDGHVV
AEIVASWTGIPLGRMVKDEIQTVLNLQPLLAARVIGQDHALEAIAQRVRTASANLEDPNKPRGVFMFVGP
SGVGKTETALALADVLYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLL
DEVEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSQAVMQACLNKSAEELPDADALAET
LRPQLYKAFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIESNHKAVFEWDESLVDAVLARCTEV
DSGARNVDHILNGTLLPEVAQHVLERIANGATIERISVRSSEAGEFEYAVV
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2527016-2529691 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGAGTACGTCCCTCAACACCCTGATCGCCAAACTCAATCCGACCTGCCGGCAGGCAGCGTTGCAGGCGG
CAAACAACTGTCTCGCGCGCGGTCATTACGAGGTGGACCTCGAGCATCTGCTGCTGGCGTTGCTCGACGA
ACCGGCGAGCGATCTCGCGCTCGTGCTGCGCGCAAGCAGCATCGACCTGCATGCGTTGCGTGCGGATATC
GAGCGCGAATTGCAGCGCCTGAAAAGCGGTAATACGCGCACGCCGGTGTTTTCCAGGCATCTGATCGATC
TGCTCGAACAGGCGTGGTTGATTGCATCGCTCGATTCGCAGATTGGACGCATTCGCTCGGGCCATTTGTT
GCTGGCATTGCTGAGCGCGCCGGATCTCGCGCAGTTTGCCGAGCGCATGTCGCCGCTCTGGCGCGACGTG
CGCGTGACCGATCTCAAGCATAAGTTCGACGAACTGACGGCGGGCTCCTGCGAAGTCGAGCGCAGTCAGG
ACGGGCAAGCCGCCACGGACCGTGCCGACGATCCGGCCACGTCCGCTTCCATGCCCGGCACGCCGTCCAG
AACACCCGCGCTCGATACGTACACCAGCAACCTCACGCAGCGCGCGCGCGAAGGCAAGATCGACCCCGTG
ATCGGCCGCGAAGGCGAGATTCGCCAGACTATCGACATTCTGATGCGGCGCCGGCAGAACAATCCGATCA
TGACGGGCGAGGCGGGCGTCGGCAAGACAGCGGTTGTCGAAGGTCTGGCGCTGCGCATCGCGGCCGACGA
CGTGCCCGCGCCGCTCAAGGGCGTGGCGCTGCACGTGCTCGACATGGGGCTGTTGCAGGCAGGCGCGAGC
GTGAAGGGCGAGTTCGAAAACCGCCTGAAAAGCGTGATCGATGAAGTGAAGAAGAGCCCGCATCCAATCA
TTCTGTTTATCGACGAAGCGCATACGATCATCGGCGCGGGCGGCCAGGCAGGACAGAACGATGCGGCAAA
CCTGCTCAAGCCCGCACTGGCTCGCGGCGAACTGCGCACCATCGCAGCGACGACGTGGAGCGAATACAAG
AAGTACTTCGAGAAAGACGCGGCACTCGCACGGCGTTTCCAGGTCGTGAAGATCGAAGAGCCGAGCGAAA
CGCTTGCGGCGGCCATGTTGCGCGGCATGGCGTCGTTAATGGAAAAGCACTTCAACGTGCGTGTGCTCGA
CGACGCAATCACCGAGGCGGTGCGCCTGTCGCATCGCTACATTAGCGGGCGGCAGCTGCCGGATAAGGCG
ATCAGCGTGCTCGACACCGCGTGCGCAAAAGTGGCGCTCGCGCATAGTTCGACACCGGCCGCTATCGACG
ATACGAAAAAGCGCCTCGAGCGCATCGACGCGGAAATTGCCGCGCTCGAACGCGAGGCGGCGAGCGGGGC
GCAGCACGACGAACGGCTCGCGCAACTGCGCGAACTCCGCGAGGAAGACCTGCAACACCTCGCTGAAGAT
GAGGCGCGCTACGACAGGGAACGCGCGCTCGTGACGGAGATTGTCGACCTGCGTGCTGAAATCGACGCGG
CTCGCGTGAGCAGCGCCGACGCGCAGCAGGCGGAGAAAGCGCAGCAGGCGCGTGAAACGCTCGCGCTGCG
GGTGGCCGAATTGCAGGCTTTGCAGGGTACTCAACCGATGGTGCCGTTGCAGGTGGACGGACACGTCGTT
GCGGAAATCGTGGCGTCGTGGACCGGCATTCCGCTCGGCCGCATGGTCAAGGATGAAATCCAGACCGTGT
TGAATCTGCAGCCGTTGCTGGCCGCGCGCGTAATCGGCCAGGACCACGCGCTCGAAGCGATCGCGCAGCG
CGTGCGCACGGCGAGCGCGAATCTCGAAGATCCAAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGACCT
TCGGGTGTCGGCAAGACCGAAACGGCATTGGCACTTGCCGATGTGTTGTACGGCGGCGAGCGCAAGATGG
TCACGATCAACATGAGCGAGTACCAGGAAGCGCACAGCGTCTCGGGTCTGAAAGGCTCGCCGCCCGGCTA
CGTCGGTTATGGCGAGGGCGGGGTGTTGACCGAGGCGGTGCGCCGCAATCCGTATTCGGTGGTGCTGCTC
GACGAGGTGGAAAAGGCGCATCCCGATGTACTCGAAATGTTCTTCCAGGTGTTCGACAAAGGCACGATGG
ACGACGCCGAAGGCCGCGAAATCGACTTCCGCAATACGCTGATCATTCTCACGTCGAATGTCGGTTCGCA
AGCGGTCATGCAGGCGTGCCTGAACAAAAGCGCAGAGGAACTGCCCGATGCGGACGCGCTCGCCGAAACC
TTGCGTCCGCAACTGTATAAGGCGTTCAAGCCGGCTTTTCTCGGCCGCATGAAAGTGGTGCCGTACTATC
CGATTTCCGACGATGTGCTCGCCGAGATTATCGAACTGAAACTGGAGAGAATTCGCCGCCGTATCGAGTC
GAACCACAAGGCGGTATTTGAGTGGGACGAGTCGCTGGTCGATGCGGTGCTTGCCCGCTGCACGGAAGTG
GATTCGGGCGCGCGCAACGTGGACCACATTCTGAACGGTACGCTGCTGCCCGAAGTCGCGCAGCATGTGC
TGGAGCGCATTGCGAACGGCGCGACGATCGAGCGCATTTCGGTGCGCTCGAGCGAGGCCGGCGAATTCGA
GTACGCCGTCGTATAA
 Primer design