SecReT6
Protein ID: 307727733
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5742
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2529727..2530845 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE1TGI9
KEGG IDbgf:BC1003_5742
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-24, Aligned region: 55..116
Protein Sequence: 372 a.a.     [Download]
>gi|307727733|ref|YP_003910946.1| type VI secretion-associated protein, ImpA family [Burkholderia sp. CCGE1003]
MPINLNTLLAPISEAAPCGEDLLFSADFDAIAHARRFEDPSLDQGEWVTEIKEADWPFVIERSSALLQTQ
TKDLRLAVWLTEALAIEEGVTGLTQGYTLITGLCEKYWETVHPLPEGDDTEYRLGNVAWLVGRTGELLRA
MPLTSSQGNVYSTIDWDVAAHVAQAVKRDPDHADDIARGKPSIEQIDASKRATPAAFYSTLLADLKAFEA
AMLALEQELDRRAGDFAPSFRQAKDAYESVYRLAERFAREVGVHPQAQQTSMSGATAPALQEPERAEPTF
KTSLQREEPVLTTTQSQAIAGIQSRAQAVAQLRAVARFFRSTEPHNPAAYFADKAAEAADMPLHQWLSTV
VKDDGSLAHIRELLGVKPEENS
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2529727-2530845 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGCCCATCAATCTGAACACGCTGCTCGCTCCAATCAGCGAAGCTGCGCCCTGCGGCGAAGATCTTCTGT
TTTCCGCCGACTTCGATGCCATTGCGCACGCACGGCGTTTTGAGGACCCTTCTCTCGATCAGGGCGAATG
GGTCACCGAAATCAAGGAGGCCGACTGGCCGTTCGTGATTGAACGTTCCAGTGCCTTGCTGCAAACCCAG
ACGAAAGACTTGCGGCTTGCGGTGTGGCTCACGGAAGCGCTCGCCATTGAAGAAGGCGTGACGGGTCTCA
CGCAGGGTTACACGCTGATCACGGGGCTGTGCGAAAAGTACTGGGAAACCGTTCATCCGCTACCGGAAGG
CGACGACACCGAGTATCGCCTCGGCAACGTCGCGTGGCTCGTCGGCCGCACCGGCGAGCTGCTGCGCGCG
ATGCCGCTCACGTCGTCGCAGGGCAACGTGTACAGCACGATCGACTGGGACGTCGCCGCGCACGTCGCGC
AAGCCGTAAAGCGCGATCCCGACCATGCCGACGACATTGCACGCGGCAAACCCTCCATCGAACAGATCGA
CGCTTCGAAGCGCGCCACGCCTGCCGCGTTTTATTCAACGTTACTGGCTGATCTCAAGGCATTCGAAGCA
GCCATGCTCGCGCTGGAACAGGAGCTCGACCGCCGCGCTGGCGACTTCGCGCCGAGCTTCCGCCAGGCGA
AGGACGCCTACGAAAGCGTCTATCGTCTTGCCGAACGCTTCGCGCGGGAAGTCGGCGTGCATCCGCAGGC
ACAACAGACGTCCATGAGTGGTGCAACTGCACCGGCGTTGCAGGAACCCGAGCGCGCCGAGCCCACTTTC
AAGACATCACTGCAACGCGAGGAACCTGTGTTGACGACCACGCAAAGCCAGGCAATCGCAGGAATCCAGA
GTCGCGCGCAAGCCGTCGCGCAGTTGCGCGCAGTGGCCCGCTTCTTTCGCAGCACCGAGCCGCACAATCC
CGCTGCATACTTCGCCGACAAAGCCGCGGAGGCCGCCGACATGCCCTTGCATCAGTGGCTTTCCACAGTG
GTGAAAGACGACGGATCGCTCGCGCATATCCGCGAGTTGCTGGGTGTGAAGCCGGAAGAAAACAGCTAG
 Primer design