SecReT6
Protein ID: 307727734
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5743
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2530987..2531952 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDE1TGJ0, E1TGJ0
KEGG IDbgf:BC1003_5743
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.70E-26, Aligned region: 157..188
OmpA [PF00691], Evalue: 4.70E-26, Aligned region: 219..313
BON [PF04972], Evalue: 4.30E-05, Aligned region: 93..130
BON [PF04972], Evalue: 4.30E-05, Aligned region: 167..180
Pilus_CpaD [PF09476], Evalue: 0.0015, Aligned region: 164..190
Pilus_CpaD [PF09476], Evalue: 0.0015, Aligned region: 215..298
Protein Sequence: 321 a.a.     [Download]
>gi|307727734|ref|YP_003910947.1| OmpA/MotB domain-containing protein [Burkholderia sp. CCGE1003]
MTHPRIRINMRLPRVLLAVLAGSLFSTLAHADNDGPARVTPVDNSSTSIRTAALPSTSSAGPAVNTAGLA
SGTTGAGTGAVTASPPPANAAPGQVVVGGKVPDEATKAAVLARLRETYGAANVVDQIEVADVATPPNWSA
NVQKLIGPQLKQISRGQLKIDGTQIDVKGEVRNESQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQ
TLANRTIEFETGSATLTAQGRAILDQMAAAMQKMTTRTVAIIGHTDNSGNRTSNIALSQARADAVKGYLV
AKGIPPQQMTTTGVGPDQPIATNDTADGRARNRRIEFRAGS
 
Nucleotide Sequence: 966 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c2531952-2530987 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGACCCACCCACGCATCCGGATAAACATGCGGCTCCCACGGGTGCTGCTTGCCGTGCTGGCCGGTTCGC
TTTTCAGCACGCTCGCTCATGCCGATAACGACGGTCCCGCACGCGTCACCCCCGTGGACAACAGCAGCAC
CTCGATTCGCACGGCGGCCCTGCCGTCAACTTCGTCCGCGGGACCTGCGGTCAACACGGCGGGCCTCGCG
AGCGGTACCACTGGCGCCGGCACCGGCGCGGTGACAGCTTCGCCGCCGCCCGCCAATGCGGCGCCTGGCC
AGGTCGTGGTCGGCGGCAAAGTGCCCGACGAGGCGACTAAAGCCGCCGTGCTCGCGCGTTTGCGCGAAAC
ATATGGCGCGGCCAACGTGGTCGACCAGATAGAGGTTGCCGACGTCGCCACGCCGCCGAACTGGTCGGCC
AACGTGCAAAAGCTGATCGGCCCGCAACTGAAGCAGATCAGCAGAGGGCAACTGAAAATAGACGGCACGC
AGATCGACGTGAAAGGCGAAGTGCGCAACGAGTCGCAACGTCAGCAACTCGCAAGCGACATGGCCAACGC
GCTCAATCCAACCTATACGATCAAGAACGGCCTGCGCGTGAGTGCGTCCGAGCAGGGTCTGCTCGATCAG
ACGCTCGCCAACCGCACGATCGAATTCGAAACCGGCAGTGCGACGCTCACGGCGCAGGGCCGCGCGATTC
TCGACCAGATGGCGGCCGCCATGCAGAAGATGACGACAAGGACAGTCGCGATCATTGGCCACACCGACAA
CTCGGGCAACCGCACGTCGAATATCGCGCTGAGTCAGGCGCGCGCCGACGCGGTGAAGGGTTATCTCGTC
GCCAAGGGCATTCCACCGCAGCAGATGACCACGACTGGCGTGGGTCCGGATCAGCCGATCGCAACGAACG
ACACCGCCGATGGCCGCGCGCGCAACCGGCGCATCGAGTTCCGCGCGGGATCCTGA
 Primer design