SecReT6
Protein ID: 307727736
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5745
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2532946..2536860 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE1TGJ2
KEGG IDbgf:BC1003_5745
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.20E-71, Aligned region: 190..448
IcmF-related [PF06761], Evalue: 2.00E-55, Aligned region: 495..847
DUF1215 [PF06744], Evalue: 6.10E-28, Aligned region: 979..1094
Protein Sequence: 1304 a.a.     [Download]
>gi|307727736|ref|YP_003910949.1| type VI secretion protein IcmF [Burkholderia sp. CCGE1003]
MRRFLNVLTHPRTLSIIGLLALAAVLFVGADTLQIDPKWPALVLAVVVALWLLVWVVRRLRARRANNRLG
EMLEQQAEKQSAEAGPAPTPARQAELDVLRTRLVDAVRTIKTSKIGQLSGGSALYELPWYIVIGNPAAGK
SSAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRTEWLGFLGLLKRFRPK
APINGIIVTASIAELTSSKPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSDRH
EYDRVWGATLPYEPDEKRDVVGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALR
AFLATLFETNPFQYKPIFRGFYFTSALQEGETNSAAATRIANRFGLSAESMPKPHSAFSKNGFFLRDLFS
KVIFADRQTVRQFASPAKTRLRYATFFGFVAVLALALGGWTWSTINNQQLAENVKADLDNVVRLQQNRND
LQSRLQAMDVLEDRIDQLEQFRRDKPLAVSFGLYQGDRLEQRLLTEYYNGVRQILLDPVSQNLAAFLKEV
DAHPDQLAPLNRTPDAAAVPVSAHNAMAANGQGGLYSDASPTNVEDAYNALKTYLMLSDKRHVETAHLTD
QVARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQ
RVYEEIKARASTRFAPMTIARIVGENNTGLVAGSYAIPGTFTREAWFQYVQPAIREAATKELQAKDWVLN
TSAHDDLTLEGSPEQIQKALVTMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLE
TAYDQTSWDNPSLFNASLKRAQSGVTSWFKQWFSRAPTGQLNANIDINGNPVEMPMGPIGQEFSALGRIV
VTGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSELADSLKYVDEQMLTGLTDSQ
RKALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQTFQSSLANKYPFASDAKVEAGAGEIAQVFGPDG
SIAKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPDFTNGFARWVAPLAGGAAGASAGQSSAEPQTVFQI
LPQPSSGTTEYTLAIDGQQMRYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLI
NSAQRKRRPDGTFDLSWTQGNVTVAVSMRIISTSQASGGSSDAPQQQSLRGLRLPSSVADVSAAGNSVVA
TNTATSAATSAAAGAAPITPSSTPPTAPAARPATAAVSTQGGAQ
 
Nucleotide Sequence: 3915 bp     [Download]
>gi|307725550|ref|NC_014540.1|:c2536860-2532946 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGCGACGCTTCCTCAACGTGTTGACCCATCCACGCACGCTCTCGATCATCGGCCTGCTCGCGCTCGCGG
CTGTGTTGTTCGTCGGCGCCGATACATTGCAGATCGATCCGAAGTGGCCAGCCCTCGTGCTTGCCGTGGT
GGTCGCGCTGTGGCTGCTGGTATGGGTGGTGCGCCGCCTGCGCGCGCGTCGCGCGAACAACAGGCTTGGC
GAAATGCTCGAGCAGCAGGCGGAAAAACAAAGCGCGGAAGCGGGGCCCGCCCCCACGCCGGCACGCCAGG
CAGAGCTCGACGTGCTGCGCACGCGTCTGGTCGACGCGGTGAGAACGATCAAGACCTCGAAGATCGGTCA
GCTATCGGGGGGCTCGGCATTGTACGAGTTGCCCTGGTACATCGTGATTGGCAATCCCGCTGCGGGCAAG
AGCAGCGCCGTGCTGAATTCGGGCCTGCAATTTCCGTTCGCCGACAAGAACAACGCCGTGATTCACGGCA
TTGGCGGCACGCGCAATTGCGACTGGTTCTTCACGACTGAAGGCATTCTGCTGGACACGGCCGGCCGCTA
CTCCGTGCATGAAGAAGACCGTACCGAATGGCTCGGCTTTCTCGGCCTGCTCAAACGCTTCAGGCCCAAA
GCGCCGATCAACGGCATCATCGTGACCGCGAGCATTGCGGAACTCACCAGTAGCAAGCCTGAATTCGCCA
TCAATCTGGCGAAGAACCTGCGCCAGCGCGTGCAGGAATTGACCGAGAAACTGGAAGTCTTCGCGCCGGT
CTACGTGATGTTCACGAAAGCCGATCTGATCACCGGCTTTACGGAGTTCTTCAGCGGTAGCGACCGTCAC
GAATACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCCGACGAGAAGCGCGACGTGGTGGGCCTGT
TCGACGAGCATTTCGAAGAGCTCTACGACGGCCTCAAAGAAATCAGCGTCGCGCAGATGTCCATCAATCG
CGGCAACAAGCTCTCGCCGGGCCAATTGAGCTTCCCGCTAGAGTTCTCGACCATCAAGCCCGCGCTGCGC
GCGTTCCTTGCCACGCTGTTTGAAACGAACCCGTTCCAGTACAAGCCGATCTTTCGCGGCTTCTATTTCA
CGAGCGCATTGCAGGAAGGCGAAACCAATAGCGCCGCCGCCACCCGCATCGCCAACCGTTTCGGCCTGAG
CGCCGAGAGCATGCCCAAGCCGCACAGCGCATTTTCCAAGAACGGCTTCTTCCTGCGCGACCTCTTTTCC
AAGGTCATCTTCGCGGACCGTCAAACGGTCAGGCAATTCGCGAGCCCGGCCAAAACGCGCCTGCGCTATG
CGACCTTCTTCGGCTTTGTTGCGGTGCTGGCGCTCGCGCTGGGGGGCTGGACGTGGTCGACTATCAACAA
CCAGCAACTGGCGGAGAACGTCAAGGCGGATCTCGACAACGTCGTGCGTTTGCAGCAGAACCGCAACGAC
CTGCAATCGCGTCTTCAGGCCATGGATGTTCTTGAAGACCGTATCGATCAGCTCGAACAGTTCCGCCGCG
ACAAGCCGCTTGCCGTTTCGTTCGGCCTCTATCAGGGCGATCGCCTCGAGCAGCGTCTTCTTACCGAGTA
CTACAACGGAGTGCGCCAGATCCTGCTCGATCCGGTTTCGCAGAACCTCGCGGCGTTCCTGAAGGAAGTC
GACGCGCATCCCGATCAACTCGCGCCGCTGAACCGCACGCCGGATGCGGCAGCCGTGCCGGTCTCCGCGC
ACAACGCCATGGCCGCCAACGGCCAGGGCGGGCTTTATAGCGACGCTTCGCCCACCAACGTGGAAGACGC
GTACAACGCGCTCAAGACCTACCTGATGCTGAGCGACAAGCGTCACGTCGAAACGGCTCACCTGACTGAT
CAGGTGGCGCGCTTCTGGCGCGGCTGGCTTGAAACGAATCGCGGCAACATGCCTCGCGACGAAATGATCC
GCAGCGCCGAGCGCATGATCACGTTCTACCTGTCACGCGTATCCGACGACGACTGGCCGATGATCGACCA
GAACCTCGGTCTGGTCGATCAGACCCGCGAAAACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGTCAG
CGTGTCTATGAAGAGATCAAGGCGCGCGCGTCGACCCGCTTTGCACCGATGACCATTGCGCGGATTGTCG
GCGAAAACAATACGGGGCTGGTGGCGGGCAGCTATGCAATTCCCGGCACGTTCACGCGCGAAGCATGGTT
CCAGTACGTGCAGCCCGCCATTCGCGAGGCCGCGACCAAGGAATTGCAGGCAAAGGATTGGGTGCTCAAC
ACGTCCGCGCACGACGACCTGACGCTCGAGGGCAGCCCCGAGCAGATTCAGAAAGCGCTCGTCACCATGT
ACAAGACCGAGTATGCAATGCACTGGCAGAAGTTCATGCAAGGCATTGCGGTGCAGAGCTTCGGCAGCTT
CGGCCAGGCGGTGGATGCGATGAACCGCCTTGGCGACCCGCAAGATTCGCCGATTCGCAAAGTACTCGAA
ACCGCGTATGACCAGACCTCGTGGGACAACCCTTCGCTCTTTAACGCAAGCCTGAAACGCGCGCAAAGCG
GCGTGACGAGCTGGTTCAAGCAATGGTTCTCGCGTGCGCCGACCGGTCAGTTGAACGCCAACATCGACAT
CAACGGCAATCCGGTGGAAATGCCGATGGGACCCATTGGGCAGGAGTTCTCCGCGCTCGGCCGGATCGTC
GTGACGGGCGACAACGGCTCGATGCTCAAGGGCTATATGGACACGCTCTCGAAGGTCCGCACGCGCTTTA
ACGTCATCAAGAATCAGGGCGATCCGGGTCCGGGCGCGCGCCAGCTCATGCAGCAGACACTCGACGGCAG
CGGCTCCGAACTCGCCGATTCGCTCAAATACGTCGACGAGCAGATGCTCACGGGCCTCACCGATTCGCAA
CGCAAGGCGCTGCGTCCGCTGCTCGTGCGCCCGCTGATGGCCGCGTATGCGGTGGTGATCCAGCCGGCCA
GCGTCGAAGTGAACAAGGTCTGGAACGCGCAGGTGTACCAGACGTTCCAGAGCTCGCTCGCAAACAAGTA
TCCGTTCGCGAGCGATGCCAAGGTCGAGGCCGGCGCGGGCGAAATAGCGCAGGTGTTCGGCCCGGACGGC
TCGATTGCGAAGTTCGTCGGCACCACGCTCGGGCCGCTTGCGGTGCGCCGTGGCGACACGCTGACTGCGC
GCACCTGGGGCGACATGGGCCTCGCGCTCACACCCGACTTCACCAACGGGTTCGCACGTTGGGTCGCGCC
GCTCGCCGGCGGCGCAGCGGGCGCGTCGGCGGGCCAGAGCTCGGCGGAACCGCAGACGGTGTTCCAGATC
CTGCCGCAGCCGAGCAGCGGCACGACCGAGTACACGCTCGCCATCGACGGCCAGCAGATGCGCTATCGCA
ACACGCCGCCGCAATGGACCAACTTCGTGTGGCCGAACCCGTCGGGCTCGCCAGGCGCCACGTTGTCCGC
AACGACCTTCGACGGCCGCACTCTGCAGCTCGTCAACGAGCCGGGCCGCTATGGGCTCGAGAAACTGATC
AACTCGGCGCAGCGCAAGCGTCGCCCCGACGGCACCTTCGATCTGTCGTGGACGCAAGGCAACGTGACGG
TGGCCGTCAGCATGCGGATCATCAGCACGTCGCAAGCATCGGGCGGCAGCAGCGACGCGCCGCAGCAGCA
GAGCCTGCGCGGCTTGCGTCTGCCTTCGTCGGTGGCGGACGTCAGCGCGGCGGGCAATTCGGTGGTCGCC
ACTAACACGGCCACGAGCGCGGCGACCAGCGCGGCCGCCGGCGCGGCACCCATCACGCCGAGCTCGACAC
CCCCGACGGCGCCGGCGGCGCGCCCCGCCACGGCAGCTGTTTCGACCCAAGGAGGCGCGCAATGA
 Primer design