SecReT6
Protein ID: 307727754
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5763
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2558371..2561553 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDE1TGL0
KEGG IDbgf:BC1003_5763
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-77, Aligned region: 177..492
Phage_base_V [PF04717], Evalue: 5.50E-21, Aligned region: 528..620
Lipase_3 [PF01764], Evalue: 0.0033, Aligned region: 912..951
Protein Sequence: 1060 a.a.     [Download]
>gi|307727754|ref|YP_003910967.1| type VI secretion system Vgr family protein [Burkholderia sp. CCGE1003]
MCLSQSIGRLPNLVLINQSDQPTTFNVFVTLFSLKIPAGSFWESNVSVIFRLRKSAKNKIGICRAGGIMS
FNNASDGISGSGGSVAGVLGSAGSLAGLASNVGAISPSAAGVVNQAARAAQLAQTASSLIGKTPAAVADA
INTLASKPVLTQQNRFMSIRTPLGPDVLLVTALVADEYLNQLSEIHLDLISQKRDIPIDSLVGQVVSVSL
TAERSGVVSALSAKGNAATERYFHGFVISFSRVGNSGTVTRYEMTVVPWLWFLTRSTDCRIFQDKTPPDI
LTEIFSEFGFTDFELNLQGTYKPFEYIVMYRESYFNFVARLMEQEGIIWWVRHEKDRHVLVITDSNAGFR
GIDDLTEIPFYADSAASEKNGISQWNEAFSFRVGKITYRDFNHRTPSTPLLHVEVPSTLRNPNIQNTERY
EYHSLYDHGEDGERYARFAMEAEEAQAHHFNGASYVQKLAPGLKFKLVNHPVSAYNNKDFVLLHVRHEAA
NDYTHESNEFPYRNSFSCLPMDIPYRPERRTPKPYMYGTQSAVVVGPKGAEVHTDGSSVKVHFFWDRRGR
QDGSDSMWVRVAQSWAGGGWGGSAMPRTGQEVLVAFNEGDPDNPIIVGRVFNGEKANPYHDTAGRTMGFR
SKTINGDGFNELKFSDVAGSEEVFVHAQKDLNAVIKDSETRSIEGGNRLVRLHAGDETKDIAKGSLTETI
AKARATTANTIDTKAVGGEAGPGNQTHQATDQIEHRVGSSIITMKPDSIKLSHGASSILINQSGIFLDGP
VIHLNQGLFVTPDQALAIQWAQQQAIIAAGLASPDPKVRDAAKRLQASVKAQQMAKLADAVYSPGTAPPG
WSNISNDPEALKKFGLRPADLSIPGSNFGAQAYAPDPAVFGDSMKPTVAFKGTEQLTGEDMSNNIAQGQG
HESAYYGRAVKIGKTVQASGNASDLDLTGHSLGGGLASAAAEASGSSATTFNAAGLNSGTLSLYGATPVR
ASITNYRVDGDILTGLQEGKLGPISDATASVMPKAVGEQIDIPGSAMTTLSRHKMAQVNAGMESTVADQQ
SSLLQILGSH
 
Nucleotide Sequence: 3183 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2558371-2561553 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
TTGTGCCTAAGCCAGTCGATAGGCCGGCTGCCGAATCTCGTCTTAATCAATCAATCGGATCAGCCGACGA
CATTTAACGTTTTTGTTACACTCTTCTCGCTAAAAATTCCCGCGGGTAGTTTTTGGGAATCAAATGTTAG
CGTAATATTCCGCCTGCGCAAAAGCGCCAAGAACAAAATCGGCATTTGCCGCGCTGGGGGCATTATGAGT
TTCAATAACGCAAGCGATGGGATATCTGGCAGCGGAGGCTCTGTTGCCGGGGTATTGGGGAGTGCGGGAT
CGCTCGCAGGACTCGCGAGCAATGTGGGCGCCATCAGCCCCTCGGCTGCCGGCGTGGTCAACCAGGCGGC
GCGCGCGGCTCAATTAGCTCAGACGGCATCCAGCCTGATCGGCAAGACGCCTGCCGCGGTTGCCGACGCA
ATCAATACGCTGGCAAGCAAGCCCGTTCTCACTCAACAAAACCGGTTCATGTCCATCCGGACGCCGCTCG
GGCCGGACGTGTTGTTGGTAACGGCGCTCGTTGCGGACGAATACCTCAATCAACTGTCTGAGATTCATCT
CGACCTTATCTCCCAAAAACGTGACATTCCGATTGATTCGCTAGTGGGCCAGGTCGTTTCAGTCTCACTA
ACCGCTGAGCGGTCCGGCGTGGTGTCGGCGCTGTCCGCAAAGGGCAACGCTGCGACGGAGCGTTATTTTC
ACGGTTTCGTAATTTCCTTCTCGAGAGTCGGAAATTCCGGCACGGTAACCCGATATGAAATGACGGTCGT
TCCGTGGTTATGGTTTTTGACACGCTCGACGGACTGCAGGATTTTCCAAGATAAGACGCCGCCCGATATT
TTGACGGAAATATTTTCCGAGTTCGGCTTTACCGACTTCGAGCTGAATCTTCAGGGGACCTATAAGCCCT
TTGAGTACATTGTCATGTATCGGGAGTCGTACTTCAATTTCGTTGCCCGGCTGATGGAGCAGGAAGGCAT
CATCTGGTGGGTTCGCCATGAGAAGGACAGGCATGTCCTCGTGATAACGGACAGTAATGCTGGCTTTCGC
GGCATCGATGATTTGACGGAGATTCCGTTCTACGCGGACAGTGCTGCCAGCGAGAAGAACGGCATATCAC
AATGGAACGAGGCGTTCAGTTTCCGCGTCGGCAAAATCACCTATCGCGATTTCAACCATCGTACGCCGTC
TACGCCGCTCCTTCATGTCGAGGTGCCGTCCACTCTCCGAAATCCGAACATTCAGAACACCGAGAGATAC
GAATATCATTCGCTATACGATCACGGCGAGGACGGTGAACGTTACGCACGTTTCGCAATGGAAGCGGAGG
AGGCGCAAGCCCATCATTTCAATGGAGCGTCGTACGTTCAGAAGCTTGCCCCGGGCTTGAAGTTCAAGCT
CGTTAATCACCCCGTGTCTGCGTACAACAACAAGGACTTCGTACTTCTTCACGTGCGGCACGAAGCCGCT
AACGATTACACCCACGAGTCGAACGAGTTTCCATACCGGAATTCGTTCTCTTGCCTGCCGATGGACATCC
CTTATCGGCCGGAGCGTCGCACGCCAAAGCCTTACATGTACGGCACCCAGTCGGCGGTAGTCGTCGGCCC
GAAAGGTGCCGAGGTCCACACCGACGGCAGCTCGGTGAAGGTGCATTTTTTCTGGGACCGCCGCGGCAGG
CAGGATGGCAGCGACTCAATGTGGGTGCGTGTGGCCCAGTCATGGGCCGGCGGAGGCTGGGGCGGCTCGG
CGATGCCGCGCACGGGGCAGGAGGTACTTGTAGCATTTAACGAGGGGGACCCGGACAATCCCATCATCGT
GGGCCGAGTGTTCAACGGCGAGAAAGCGAACCCATACCACGACACGGCTGGCCGAACCATGGGGTTTCGC
AGCAAGACGATAAACGGCGACGGATTCAACGAACTGAAGTTTTCGGATGTCGCGGGCTCGGAAGAGGTTT
TCGTCCATGCACAAAAGGACCTGAATGCCGTTATCAAGGATAGTGAAACCCGCTCTATCGAAGGCGGCAA
CCGGCTCGTGCGGCTGCACGCCGGCGATGAAACGAAAGACATTGCCAAAGGCAGCTTGACGGAGACAATC
GCAAAGGCGCGCGCGACGACGGCTAATACGATCGATACCAAAGCGGTCGGCGGTGAGGCTGGGCCTGGCA
ACCAGACGCATCAGGCAACAGACCAGATAGAGCATCGCGTGGGCTCGAGCATCATCACGATGAAGCCCGA
CAGTATCAAGCTGTCGCACGGCGCGTCGAGCATCCTGATCAACCAGAGCGGAATTTTCCTTGACGGACCG
GTAATCCACCTGAATCAGGGCCTGTTCGTGACGCCGGATCAGGCGTTGGCCATTCAGTGGGCACAGCAGC
AGGCGATCATCGCGGCGGGCCTGGCGAGCCCCGATCCTAAGGTGCGCGACGCCGCAAAGCGGCTGCAGGC
ATCTGTGAAGGCGCAGCAGATGGCGAAGCTCGCGGACGCAGTGTATTCGCCAGGTACCGCGCCGCCCGGA
TGGTCGAACATCAGCAACGATCCTGAGGCTTTGAAGAAATTCGGCCTACGGCCGGCAGATCTGTCCATAC
CGGGAAGCAACTTCGGGGCACAGGCGTATGCGCCTGACCCCGCTGTGTTCGGCGACAGCATGAAGCCAAC
GGTGGCGTTCAAAGGTACCGAACAGCTGACGGGTGAGGACATGTCGAATAACATCGCACAAGGTCAGGGC
CACGAGTCCGCCTATTACGGGCGGGCAGTAAAAATAGGCAAGACCGTGCAAGCCTCGGGCAATGCTTCGG
ATCTTGACCTCACGGGTCACTCGCTCGGTGGTGGCCTCGCGTCAGCGGCCGCAGAGGCAAGCGGGTCGAG
CGCAACGACCTTTAACGCCGCGGGATTGAATTCCGGGACACTCTCACTGTACGGAGCGACACCGGTCCGC
GCTTCGATAACCAATTACCGCGTCGACGGCGACATCCTGACTGGATTGCAGGAAGGGAAACTTGGTCCGA
TCAGTGACGCCACAGCGTCAGTCATGCCAAAGGCTGTGGGCGAGCAGATCGATATCCCGGGCAGCGCGAT
GACGACGCTGTCCCGCCACAAGATGGCGCAGGTCAATGCTGGAATGGAATCAACGGTTGCAGACCAACAG
TCGTCGCTGCTTCAGATTCTAGGATCGCACTAA
 Primer design