SecReT6
Protein ID: 307727757
SecReT6 ID499
T6SS typei4b
Gene symbol-
Locus tagBC1003_5766
StrainBurkholderia sp. CCGE1003
Repliconchromosome II [GenBank: NC_014540] [Browse all T6SS(s) in this replicon]
Location [Strand]2563358..2564614 [+]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDE1TGL3
KEGG IDbgf:BC1003_5766
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-16, Aligned region: 6..18
PAAR_motif [PF05488], Evalue: 1.10E-16, Aligned region: 71..143
PAAR_motif [PF05488], Evalue: 1.10E-16, Aligned region: 140..152
DUF4150 [PF13665], Evalue: 0.0013, Aligned region: 52..97
DUF4150 [PF13665], Evalue: 0.0013, Aligned region: 104..135
DUF4150 [PF13665], Evalue: 0.0013, Aligned region: 143..154
Protein Sequence: 418 a.a.     [Download]
>gi|307727757|ref|YP_003910970.1| PAAR repeat-containing protein [Burkholderia sp. CCGE1003]
MDSLLAAARLGDPVAHTASKGWMIAGLIGGALLGAAVVALTGGTALIALAAVAAGAAAGGGIGEVLGTMS
WAPRHVTGSLISGSPNVFINSRSAIRAHISNGLCNDHSGAPQVVAQGSSTVFINSQPASRKEDMLACSAV
ISDGSPNVFIGGARQTTDDISPEVPAWMNWAMLGVGIAAAVVLAGPVVGLIGAAGGFLGGELGFAVGGAV
FGEGSDGQKWSMLGGSLVGGGLAGKGAGMLEAPKEPVPVAVLETPKEPVAAPVSRFDYTVDKVPADLEPN
SAGVYGYMPKEGTEFHQSKWGVDWTDREATAGATAKRISYHEGMEQKEAWIADQRSAGVPDEQIARQITN
SRNADRLSYYTEEQLPGVYARNLARYGDKMGPSYEYLIESGKTPQQIIQSATRTNPSMDILTGIAKVK
 
Nucleotide Sequence: 1257 bp     [Download]
>gi|307725550|ref|NC_014540.1|:2563358-2564614 Burkholderia sp. CCGE1003 chromosome 2, complete sequence
ATGGACTCGCTACTCGCCGCAGCCCGACTCGGAGACCCGGTGGCGCACACCGCTTCAAAAGGCTGGATGA
TCGCCGGTCTGATAGGTGGCGCATTGCTTGGCGCAGCAGTCGTAGCACTCACAGGCGGCACAGCATTGAT
CGCGCTGGCCGCAGTCGCAGCGGGAGCTGCTGCAGGTGGTGGTATCGGCGAAGTACTGGGCACCATGTCG
TGGGCGCCGCGGCACGTTACAGGCAGTCTGATATCAGGGTCGCCAAACGTCTTCATCAATAGCCGCTCAG
CGATTCGCGCGCACATCAGTAACGGGCTTTGTAATGACCACTCAGGCGCCCCTCAGGTCGTTGCCCAGGG
TTCGAGCACCGTCTTTATCAACAGCCAGCCCGCAAGCCGCAAGGAGGATATGCTTGCCTGCAGCGCGGTC
ATCAGTGACGGCTCGCCGAATGTGTTCATCGGCGGCGCCCGCCAGACGACCGACGATATCAGCCCCGAGG
TTCCGGCCTGGATGAACTGGGCGATGCTCGGGGTTGGTATTGCTGCGGCGGTTGTGCTCGCGGGGCCCGT
TGTCGGCCTGATCGGCGCAGCAGGCGGATTCCTCGGCGGGGAACTCGGCTTCGCGGTCGGCGGTGCTGTT
TTCGGCGAGGGTTCGGATGGCCAGAAGTGGTCGATGCTGGGTGGATCGCTCGTTGGCGGCGGACTCGCGG
GCAAGGGCGCAGGCATGCTCGAGGCGCCCAAAGAGCCCGTTCCCGTCGCTGTGCTTGAAACGCCCAAAGA
GCCTGTCGCCGCGCCTGTTTCGCGCTTTGACTATACGGTTGATAAGGTGCCCGCTGACCTCGAGCCCAAC
TCGGCTGGCGTCTACGGGTACATGCCGAAGGAAGGCACCGAGTTTCATCAGTCGAAGTGGGGTGTAGACT
GGACCGATCGCGAAGCAACGGCGGGTGCGACTGCGAAGCGGATCAGTTATCACGAGGGTATGGAGCAGAA
AGAGGCCTGGATCGCCGATCAGAGAAGCGCTGGGGTGCCTGATGAGCAGATAGCTCGGCAGATAACCAAC
AGTCGCAACGCCGACCGCCTTTCTTACTACACGGAAGAGCAGTTGCCGGGCGTGTACGCGCGCAACCTCG
CCAGGTATGGCGACAAGATGGGGCCGAGCTACGAGTATCTGATCGAGAGCGGGAAAACACCTCAACAGAT
AATACAAAGCGCAACCCGCACCAACCCGTCCATGGACATTCTCACAGGCATCGCGAAAGTCAAATGA
 Primer design