SecReT6
Protein ID: 307729028
SecReT6 ID496
T6SS typeN/A
Gene symbol-
Locus tagBC1003_0980
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]1109015..1112548 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE1TC41
KEGG IDbgf:BC1003_0980
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.20E-74, Aligned region: 414..739
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 875..993
Protein Sequence: 1177 a.a.     [Download]
>gi|307729028|ref|YP_003906252.1| ImcF domain-containing protein [Burkholderia sp. CCGE1003]
MNDYKSRPAALLIGIALFILFSILGIAVWLGGREQGWSQNTRFIIELGLLSGFLLCLVFVKFFEAVLLWI
ASMWASRWLMRYDTQSNIAKSDRTTNPSGSVAEKLRDRHGWRWRWRDRWVLVAGDEPLVKRLAPGLIETG
YVFAGDAVLLYAKQTADKLDTEGLERIRRLRGRRPVDAIVAVTRNRDSGNSPFDADELSQRLASVARALR
WAAPTYLLNATNFGSEPAGPDEAIGFTWSNTRVNADEIHASLHRLARNLADAGVSRIACNKADRYPAELS
QHVERLGSALSGLVLQTGGSSYWRHTVHGLLFVPLFKERVLDPAPDSEPSDEKEARPALQHRTIWQTVAE
HSRSVHGRRVGFSFSTTTAWIATAAVFLWIAGTMMSGLTNRATISTARDTLARLTGARDNTQSMQTLDSL
DRQIDTLETHQRGGAPWVTRFGLNRDGALLEAIWPRYDAAASRIFVGPIRQTLEDRLRQLASMSDEEIAS
GGSFQAQAAYNTLKAYLMLAKPERAVAAFLAPQLVGTAAPALPVNSSLSSGTWEDLREHTIAFFADHLAR
RNPASGSSLAIEPDSSLVASTRETIIGVRGIQNSTDAVYQQILDEAKPKYPPVTLATLLGDTTGRGLFNT
TQTVPGVFTRAAWDERISKAIDEASEKGNVAGDWVLSDARAMNQTPSTLKAELRQRYFDDYARAWGQFLN
SLRWQPAPTLSATADQLALLGDTQRSPLVALINAIVYQAGTGASMQSLSDTLISKAQQLVGADEKDPSKQ
AQAQFAPLAAAFGPILRLTGSDLVSAVPGKTGKVAMQLASTGDLSLARYLERVTAMRLKVEQMVNSADTD
AMSRVAAQSVLQGKTSDIADSRDYASRVAASLGQQWAGFGQLLQAPLDQTWQAVVQPAAASLNDIWRTSI
LADWNRTFGGRYPFADSDNDASLPDMARFMRPDNGVIVQFVATQLAGVVERQGDRWVAAQGADHGSLTLD
PGFLVGLNRLTRVSTVLFPAGDAHIRFDLRGIATPGVTSMKIVLSGREFDYFNQKEEWVPFEWPGQSLEN
LSHIEWQTEQGGLRSALDAQGRFGLVRLLERAKVTQQDNARYLLTWAPDTSEGIALKVQLRIDAGAGPLD
VLQLRHFTLPARIFVTGGAKAGPRISASNPPPLPPAAIAAAKHAAMPLPHGFVPENE
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|307728076|ref|NC_014539.1|:1109015-1112548 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGAACGATTACAAGTCACGTCCCGCGGCGCTCTTGATTGGCATCGCTCTTTTTATCCTGTTTTCTATTC
TTGGCATTGCGGTGTGGTTGGGAGGACGGGAACAAGGGTGGAGTCAGAACACACGGTTCATTATTGAACT
GGGTCTTCTGTCCGGTTTCCTGCTTTGCCTGGTTTTTGTAAAGTTTTTTGAGGCCGTTCTTCTATGGATC
GCTTCCATGTGGGCAAGCAGATGGCTGATGCGATACGACACCCAATCGAACATTGCGAAATCAGATCGGA
CTACCAATCCGTCCGGGTCCGTTGCAGAAAAGCTTAGAGACCGTCATGGCTGGCGATGGCGGTGGCGCGA
TCGCTGGGTGCTTGTCGCCGGAGACGAACCACTTGTGAAACGCTTGGCCCCGGGGCTGATCGAGACCGGC
TACGTGTTCGCGGGCGATGCCGTCCTGCTATATGCGAAACAGACCGCCGACAAGCTCGACACCGAGGGGC
TTGAACGAATTCGACGCTTACGTGGTCGTCGCCCGGTCGATGCAATCGTGGCAGTAACGCGCAACCGCGA
TTCAGGCAACTCGCCGTTTGATGCGGATGAGCTTTCCCAGCGCCTTGCCAGCGTTGCGCGTGCTTTGCGA
TGGGCCGCACCGACGTATCTGCTTAACGCGACAAATTTTGGCTCCGAGCCGGCGGGCCCGGACGAGGCGA
TCGGCTTTACCTGGTCAAACACTCGCGTGAATGCTGACGAAATCCACGCCTCGTTGCATCGGCTTGCCCG
CAACCTCGCCGACGCTGGCGTCTCGCGCATCGCATGCAACAAAGCGGACCGCTATCCGGCCGAGCTGTCG
CAGCATGTCGAACGACTAGGCAGCGCGTTGTCCGGGCTCGTGCTGCAAACTGGCGGCTCAAGCTACTGGC
GGCATACGGTGCACGGGTTACTGTTCGTGCCCCTCTTCAAGGAACGGGTACTCGATCCTGCGCCCGACTC
CGAGCCGTCTGACGAGAAAGAGGCGCGGCCTGCACTACAGCACCGCACGATCTGGCAAACAGTTGCCGAG
CACAGCCGCAGCGTCCACGGCCGCCGCGTTGGTTTTTCGTTTTCAACCACCACCGCATGGATCGCCACAG
CAGCGGTCTTTCTCTGGATCGCCGGCACGATGATGTCAGGACTCACGAACCGGGCGACGATCAGTACCGC
CCGCGATACCCTCGCAAGACTCACGGGCGCCCGAGACAACACGCAGTCGATGCAAACGCTCGACAGTCTC
GACAGGCAAATCGACACACTGGAGACGCACCAGCGCGGTGGCGCTCCGTGGGTGACCCGCTTCGGGCTGA
ACCGCGACGGCGCCCTGTTGGAGGCAATCTGGCCGCGCTACGATGCCGCCGCGAGTCGCATCTTTGTCGG
CCCGATTCGCCAGACGCTCGAGGATCGTCTGCGTCAGCTCGCCTCGATGTCCGACGAAGAAATCGCCAGC
GGCGGCAGCTTCCAGGCGCAGGCTGCCTACAACACGCTCAAGGCTTATCTGATGCTCGCGAAACCGGAGC
GGGCTGTGGCGGCATTCCTTGCGCCTCAACTTGTCGGAACCGCAGCCCCCGCGCTCCCGGTCAACTCGTC
ACTGTCTTCCGGGACATGGGAAGATCTGCGCGAGCACACGATCGCCTTTTTCGCGGATCACCTCGCGCGC
CGGAATCCGGCAAGCGGCTCATCGCTTGCCATCGAACCGGATAGCAGCCTGGTCGCGTCGACGCGCGAGA
CCATCATCGGCGTGCGTGGCATCCAGAATTCGACGGATGCGGTCTACCAGCAGATTCTTGACGAGGCGAA
GCCGAAGTATCCTCCCGTCACGCTGGCCACCCTGCTTGGTGACACCACGGGGCGCGGCCTCTTCAACACG
ACGCAGACCGTGCCGGGCGTCTTCACGCGCGCAGCCTGGGACGAACGCATCTCGAAGGCAATCGACGAGG
CAAGCGAGAAGGGTAATGTCGCCGGCGACTGGGTGCTGTCCGACGCCAGGGCAATGAACCAGACGCCGTC
CACCCTGAAGGCCGAACTGCGTCAGCGCTATTTCGACGACTACGCGCGGGCCTGGGGGCAATTCCTCAAC
AGTCTGCGCTGGCAGCCCGCGCCAACGCTCTCGGCCACGGCCGATCAACTTGCTCTGCTGGGCGATACGC
AGCGCTCGCCGCTGGTCGCGCTGATCAACGCGATCGTGTATCAGGCGGGCACAGGCGCGAGCATGCAGTC
GCTGTCCGATACGCTGATCAGCAAGGCGCAGCAACTTGTCGGCGCCGACGAGAAAGACCCCTCAAAGCAG
GCACAGGCCCAGTTCGCACCGCTGGCAGCTGCCTTCGGCCCGATCCTGCGACTGACGGGCAGCGACCTGG
TTTCCGCCGTGCCCGGAAAAACCGGCAAGGTCGCGATGCAACTGGCCAGTACCGGCGATCTGAGTCTTGC
CCGCTATCTCGAGCGCGTGACCGCGATGCGCCTGAAGGTCGAACAGATGGTGAACAGCGCCGATACGGAC
GCGATGTCGCGCGTCGCGGCGCAGTCAGTGCTGCAGGGCAAGACGTCGGATATCGCGGACAGCCGCGACT
ACGCGAGCCGGGTTGCCGCGAGCCTTGGCCAGCAATGGGCGGGCTTTGGCCAGCTGCTGCAGGCACCGCT
CGACCAGACCTGGCAGGCGGTGGTGCAGCCCGCGGCGGCGAGCCTGAACGACATCTGGCGCACGTCGATC
CTCGCTGACTGGAACCGCACCTTCGGCGGACGTTATCCGTTCGCCGATTCCGACAACGATGCTTCGTTGC
CCGACATGGCGCGCTTCATGCGGCCGGATAACGGAGTGATCGTGCAGTTCGTGGCGACGCAGCTGGCGGG
TGTCGTCGAACGGCAGGGAGACCGGTGGGTCGCCGCGCAAGGCGCCGATCACGGCTCACTCACGCTAGAT
CCGGGCTTTCTGGTGGGGTTGAACCGGCTCACGCGTGTTTCGACGGTGCTGTTCCCGGCTGGCGACGCAC
ACATCCGCTTTGATCTGCGGGGCATTGCGACGCCAGGTGTGACCAGCATGAAGATTGTTTTGTCCGGGCG
CGAGTTCGACTATTTCAACCAGAAAGAGGAATGGGTGCCGTTCGAATGGCCTGGCCAGTCGCTGGAGAAC
CTGTCTCACATCGAATGGCAGACGGAGCAGGGTGGGCTGCGGTCCGCGCTCGACGCCCAAGGACGCTTCG
GACTGGTCCGTCTGCTGGAGCGCGCAAAGGTCACCCAGCAGGACAATGCACGCTACCTGCTGACGTGGGC
GCCCGATACGAGCGAGGGGATCGCGCTCAAGGTCCAGTTGCGCATCGACGCAGGTGCGGGCCCACTCGAC
GTACTGCAGCTTCGGCACTTCACACTGCCCGCACGCATTTTCGTGACGGGCGGTGCAAAGGCTGGCCCAA
GAATTTCTGCCAGCAACCCACCGCCGTTGCCGCCGGCTGCCATCGCCGCCGCGAAGCACGCGGCCATGCC
CTTACCGCACGGCTTCGTGCCTGAGAACGAATGA
 Primer design