SecReT6
Protein ID: 307731122
SecReT6 ID497
T6SS typeN/A
Gene symbol-
Locus tagBC1003_3107
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]3622840..3626316 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE1TAM6
KEGG IDbgf:BC1003_3107
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.00E-62, Aligned region: 423..746
IcmF-related [PF06761], Evalue: 1.00E-62, Aligned region: 850..856
DUF1215 [PF06744], Evalue: 6.00E-29, Aligned region: 278..298
DUF1215 [PF06744], Evalue: 6.00E-29, Aligned region: 682..705
DUF1215 [PF06744], Evalue: 6.00E-29, Aligned region: 879..998
Protein Sequence: 1158 a.a.     [Download]
>gi|307731122|ref|YP_003908346.1| ImcF domain-containing protein [Burkholderia sp. CCGE1003]
MKILRFWGAALAIVASGLLLCLWLQLDGEIFGLATDTQRLRASLVVAGACLVLLVAKEAFAPMWRKREDQ
AQQALRPSSNDRARAIPDQCAKLSSLCGELRAAHGLFWRYRLRWLLVSGANERVEQVAPGLKQAGAMHFG
DVILVHGAPDGIDASTWLGQVRRWRRRRPVDGVVHVTGVDDHAASDLPRTLSATSIALGWAAPVVCLHAV
SARGQHRDEFGPVGAFVTTRGIAHAQSKGEILNQKLSALEYATAYEGVRLCARPEPIYWLAQVSKYIAAQ
REPVVKAWQAHHMSKWRHAPLIGVMFAPVFAAPDTPVPVLAEQESIARDADERPSQLAYETREQPRALQL
VWHEIGKRVKSLDGRRVGFYWPNALFALVMIGTVGGCLAMTLSFTGNQMVLHDARQAVDAALTAQPATAP
ALRAQLALQQRIDTLEYRQQHGAPWYVRAGLNHDKALLAALWQPYGIVAMRNLRDPVARRLEASLVQLSQ
SRADALPSADEQKRDYDVLKTYLMLSQPLHADAAFLAQRVADQWPAIADMRTGEWLDVSRRLAAFYASHL
HAHPEWRLNASNDLINAARNTIVNQIGLQNSDDTLYQSVIEQAKGKYADMSLATLVNGTDSRGLFATSQT
VPGIYTRAAWDGMIAEAIDKAAKEGRVAADWVLADEGAARVPGAALEAQQDVEEVRQRLRARYFAEYTAA
WQAMLNSIQWKSATNLSDAISQLTRLTDAQTSPLIALMKAVQYQAQAGRPSQALADSLVRKAQDLIGNKT
GVTAPADVNPLDKPFGPLLALMGDDVVTGAMGGTDKSTGKQGKAAADFSGVSLAHFLTVATTMRLKLQQI
ATSADAQAMARQMAQAVFQGKLSELTQARDDAALTAASLGSQWAGFGDALFARPLDVAWQTILQPAAASL
NEAWRVAVAAPFTSSFDGHYPFADTNTDASFVELGRYIKPDTGLISRFVTTQLAGILQQQGNAWAPNELA
PQALQFDPGFLSALRQLSGLGAQLYAQGDASYRMQIMPHPNPDVSRSVLTIDGSTIEYFNQLETYTPITW
PGNGQNGHVQLAWESLTAGTRIAFAANGDWALLRLLGTAQVKPLDSTTYALTFNQGNGFPLHYDLKVQVG
AGPLDLLKLRGFKMPQRVFIVGKGGAMPALPPLPPELQ
 
Nucleotide Sequence: 3477 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c3626316-3622840 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGAAAATCCTGCGATTCTGGGGCGCAGCACTGGCGATTGTTGCGTCGGGATTACTGCTGTGTCTGTGGC
TTCAGTTGGACGGCGAGATCTTCGGATTGGCCACCGATACGCAGCGCTTGCGTGCGAGCCTTGTCGTTGC
TGGCGCTTGCCTTGTCCTGCTAGTAGCAAAGGAAGCATTCGCGCCGATGTGGAGAAAGCGAGAGGACCAG
GCACAACAAGCATTGCGGCCTTCATCCAATGATCGCGCACGGGCAATACCAGACCAGTGCGCGAAGCTAT
CGTCGCTCTGCGGCGAACTGCGTGCCGCGCATGGTTTGTTTTGGCGCTACCGCTTGCGCTGGCTGCTCGT
GAGCGGCGCGAACGAGCGAGTCGAGCAAGTCGCCCCGGGCCTCAAGCAAGCGGGCGCTATGCACTTCGGA
GATGTGATTCTTGTGCATGGAGCGCCGGACGGCATCGATGCGTCAACGTGGCTCGGTCAAGTTCGGCGGT
GGCGTCGCCGCCGGCCGGTTGACGGCGTTGTTCATGTCACTGGCGTTGATGATCATGCCGCTTCTGATCT
GCCACGCACGCTCTCGGCTACGTCCATCGCCTTGGGTTGGGCAGCGCCAGTCGTCTGCCTTCACGCCGTC
AGCGCGAGGGGTCAGCATCGGGATGAATTCGGCCCGGTCGGAGCTTTCGTCACCACGCGTGGGATTGCGC
ATGCACAATCCAAAGGCGAAATACTAAACCAGAAGTTGAGCGCGCTTGAGTACGCAACGGCGTATGAGGG
AGTGAGACTGTGCGCTCGTCCCGAGCCGATCTATTGGCTTGCCCAAGTATCCAAGTACATTGCCGCGCAG
CGTGAACCGGTGGTGAAGGCGTGGCAAGCGCATCACATGTCGAAATGGCGGCATGCGCCACTTATAGGTG
TGATGTTTGCGCCAGTATTCGCCGCACCTGACACGCCCGTACCGGTTCTGGCGGAGCAGGAGAGCATTGC
GAGGGATGCGGACGAGCGTCCTTCACAGCTTGCCTATGAAACACGCGAGCAGCCTCGTGCGTTGCAATTG
GTCTGGCACGAAATCGGCAAGCGAGTAAAGTCGCTCGATGGCCGCCGCGTCGGATTCTACTGGCCCAACG
CACTGTTCGCCTTAGTGATGATCGGTACGGTAGGCGGGTGCCTGGCGATGACTCTCTCGTTCACTGGTAA
TCAGATGGTCTTGCACGACGCACGACAAGCGGTCGATGCCGCGCTCACGGCACAGCCGGCCACCGCGCCC
GCCTTGCGCGCACAACTCGCACTGCAACAGCGAATCGACACGCTCGAATATCGCCAGCAACACGGAGCAC
CGTGGTACGTGCGAGCAGGTCTCAATCACGACAAGGCGTTGCTCGCGGCGCTATGGCAGCCGTATGGCAT
CGTGGCAATGCGCAACTTGCGCGACCCTGTCGCACGACGGCTCGAGGCATCGTTAGTGCAGCTCTCGCAG
TCACGCGCCGACGCGTTGCCGAGCGCAGACGAGCAAAAGCGCGACTACGACGTGCTCAAGACTTACCTGA
TGCTGTCGCAGCCGCTCCACGCGGACGCGGCGTTCTTAGCTCAGCGCGTCGCCGATCAATGGCCCGCGAT
CGCCGACATGCGAACCGGCGAATGGCTCGACGTTTCTCGGCGGCTGGCCGCCTTCTATGCCTCGCATTTG
CATGCGCACCCCGAATGGCGGCTCAATGCATCGAATGATCTGATCAACGCCGCGCGCAATACGATCGTCA
ACCAGATCGGGCTGCAAAATTCCGACGACACGCTGTATCAGTCGGTTATTGAGCAGGCCAAAGGCAAGTA
TGCGGACATGTCGTTGGCTACGCTCGTGAACGGCACAGACAGTCGCGGCCTGTTCGCGACCAGCCAGACG
GTGCCGGGTATTTACACACGCGCCGCGTGGGACGGCATGATTGCCGAGGCCATCGACAAGGCCGCGAAAG
AAGGGCGCGTCGCGGCCGACTGGGTGCTCGCCGACGAGGGCGCGGCCCGCGTGCCGGGTGCGGCACTCGA
GGCGCAGCAGGACGTCGAGGAAGTGAGGCAGCGCCTACGCGCACGCTACTTCGCCGAATACACCGCGGCT
TGGCAGGCGATGCTCAACAGCATCCAGTGGAAGAGCGCCACGAACCTCTCCGATGCCATCAGCCAACTCA
CTCGCCTGACTGATGCTCAAACGTCGCCGCTGATCGCGCTGATGAAGGCGGTTCAGTATCAGGCGCAAGC
GGGCCGCCCGTCGCAGGCGCTGGCGGACTCGCTCGTGCGCAAGGCCCAGGACCTGATCGGCAACAAGACG
GGCGTCACGGCGCCTGCCGATGTCAATCCGCTTGACAAGCCGTTCGGACCGTTGCTCGCGCTCATGGGCG
ACGATGTGGTGACTGGGGCGATGGGCGGGACCGACAAGTCAACCGGCAAGCAGGGGAAAGCCGCGGCTGA
CTTCAGCGGCGTGAGCCTCGCGCATTTCTTGACGGTTGCGACCACGATGCGCCTGAAGCTGCAGCAAATC
GCCACGAGCGCCGATGCGCAGGCGATGGCACGTCAGATGGCCCAGGCGGTGTTTCAGGGCAAGCTCTCTG
AACTCACGCAGGCCCGCGACGATGCGGCGCTGACTGCAGCCAGTCTCGGTTCCCAGTGGGCAGGCTTCGG
TGATGCGCTGTTCGCGCGTCCGCTCGATGTGGCATGGCAAACCATCCTGCAACCGGCGGCGGCCAGCCTG
AACGAAGCGTGGCGCGTCGCGGTGGCCGCACCCTTCACGAGTTCGTTCGACGGTCACTATCCGTTCGCGG
ACACGAACACCGACGCCTCGTTCGTCGAGTTGGGACGCTACATCAAGCCCGACACGGGTCTGATCTCGCG
TTTCGTGACCACGCAACTAGCCGGCATCCTGCAACAGCAAGGCAACGCGTGGGCGCCGAACGAGCTCGCG
CCGCAAGCGCTCCAGTTCGATCCCGGGTTCCTATCGGCACTGCGGCAGTTATCGGGGCTCGGTGCGCAAC
TCTATGCGCAGGGAGACGCGAGCTACCGGATGCAGATCATGCCGCATCCGAACCCGGACGTCTCACGAAG
CGTCCTGACCATCGACGGTTCGACGATCGAATACTTCAATCAGCTAGAGACGTACACGCCGATCACGTGG
CCAGGCAACGGGCAGAACGGACATGTGCAACTGGCGTGGGAATCGCTCACTGCGGGCACGCGCATCGCGT
TCGCCGCCAATGGCGATTGGGCGCTGCTGCGTTTGCTCGGCACGGCACAGGTCAAACCCCTCGACAGTAC
GACCTACGCATTGACCTTCAATCAGGGCAACGGTTTTCCGCTGCACTACGACCTCAAGGTGCAGGTCGGT
GCAGGCCCGCTTGATCTGCTCAAGCTGCGCGGCTTCAAGATGCCGCAGCGTGTGTTCATCGTCGGCAAGG
GTGGCGCCATGCCTGCGCTGCCGCCGCTGCCTCCCGAACTGCAATAG
 Primer design