SecReT6
Protein ID: 308186536
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1025
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1076473..1080102 [+]
Producttype VI secretion system, core protein
NoteTssM
UniProt IDE1SAE3
KEGG IDpva:Pvag_1025
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.10E-99, Aligned region: 208..486
IcmF-related [PF06761], Evalue: 5.80E-83, Aligned region: 535..836
DUF1215 [PF06744], Evalue: 1.10E-30, Aligned region: 951..1076
Protein Sequence: 1209 a.a.     [Download]
>gi|308186536|ref|YP_003930667.1| unnamed protein product [Pantoea vagans C9-1]
MLNILFAVLTSRLAWGFVGITALSFIIWVIGPVFSIVDSRPLEPEQNRMISIALLYLVWGLGQAIPRLYN
YWLNRKLMSSLETGKSDAPEADRQRLTSEEQVLAGRFSEATEMLRKAHFQRHSSKGTPFWAQRFGRQYLY
QLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKSALRGIGGTRNCDWWFTNDAVLLDTAGRYSTQESQQ
ERDASEWHHFLDLLRKYRGRQPINGVIVTLSVSDLLSQSPEALRNQALALRQRLMELHDRLGIRFPVYVL
VTKADLLKGFRSYFASLDKAQREQIWGFTFPWAKASAADFELNSQFQQEYSLLQQRLDAGLADRLLTESD
AQARAESYLFPQEFAALRPLLADALDTLFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELNRALNLPG
QQAGESGSWDQVDKDAPIPQNKGQSFFLKGVLENVVFQESGLAGSNRWWELRNRAGLWSGYLALLLLLLV
AGGLWLTSYSKNKAYLQEMAAKAPQVEQLGDQLQKQVNGDLFALVPYLNTLLHLPESADFSLESPPLTRR
MGLYRGTEVSDATRALYDKALKQLLLPQVAQNITRWLRNDNGSDADYSYEALKAYQMLYQPKHYDGKFLQ
AWLMLNLSRELPQNVTQQQVKQLAWHLQQLLETQIHSSPYAKDDALVKREQALINQMPLSQRVYGRLKRL
LQRDDSLQPVTLAALGGPQSELVFSRKSGKSVNDGVAGLYTPDGYWQHVDKQIGPVTQALYQDDLWVLDG
AAPQQKSEQTDLAVRQLYVQDYIRQWEQFLSDIQLNSSADLSQRINTARLLSGNHSPLRQLVINLSNLLT
LNRAQPDEKTAQAAKPSDNSATRTLEALFTSPEAAAARGQAAAQASPEQAVAVHFAPVLELAQPLQQGSK
VLAVDDFLHQIDDLYRYLTAVQDAANSGMPPPASDAISRLQASAGRLPGSLQNMVSSMAVGASSDAQRRD
MDNVRKRITMEVGSFCRQAIAGRYPLVRSARSEVTPDDLARMFAPGSGMMDSFFRDNLASKVDTTNASWR
FTPGIDGKTLPGGEALLRPFQQAQSIRDAFFANGATTPGFRVTLRTVKMDNDILNLTLDVDGQQLRYSHG
PQAVQMVSWPGPGGTSQVRMQLGLTNGTTSTLVTSGPWALNRFFDRARVTAAGGLTREATFSVEGHQVTL
LFTPGSIRNPFQLPGFSCP
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1076473-1080102 Pantoea vagans C9-1 chromosome, complete genome
ATGCTGAATATTCTGTTTGCGGTGCTGACCAGCCGCCTTGCGTGGGGCTTTGTCGGCATCACCGCGCTCT
CTTTTATCATCTGGGTGATTGGCCCGGTCTTCTCTATCGTTGATTCGCGGCCACTTGAGCCAGAGCAGAA
CCGCATGATCAGTATCGCGCTGCTCTATCTGGTCTGGGGACTGGGGCAGGCGATTCCACGGCTCTACAAT
TACTGGCTTAACCGCAAGCTGATGTCGAGTCTGGAAACCGGCAAAAGCGATGCGCCGGAAGCCGATCGTC
AGCGTCTGACCAGTGAAGAGCAGGTGCTGGCGGGCCGTTTCTCCGAAGCTACTGAAATGCTGAGAAAGGC
GCACTTCCAGCGCCACAGCAGCAAAGGCACGCCGTTCTGGGCGCAGCGCTTTGGTCGGCAGTATCTCTAT
CAGCTGCCGTGGTACATGATTATCGGTGCACCCGGTGCCGGTAAAACCACCGCGCTGGTCAACTCCGGCC
TGCAGTTCCCGCTGGCGGATAAGTTTGGCAAGTCGGCCCTGCGCGGCATTGGCGGCACCCGCAACTGCGA
CTGGTGGTTTACTAATGACGCCGTGCTGCTCGATACCGCCGGGCGTTACAGCACCCAGGAGAGTCAGCAG
GAGCGGGATGCCAGCGAATGGCACCATTTCCTCGATCTGCTGCGTAAATATCGCGGACGTCAGCCGATCA
ACGGCGTCATCGTCACCCTGAGCGTCTCCGATCTGCTGAGTCAGTCGCCCGAGGCACTGCGCAACCAGGC
GCTGGCGCTGCGTCAGCGTCTGATGGAGTTGCACGATCGTCTCGGCATCCGTTTCCCGGTTTATGTGCTG
GTCACCAAAGCAGACCTGCTCAAAGGTTTCCGCAGCTACTTCGCCTCGCTGGATAAAGCGCAGCGTGAAC
AGATCTGGGGATTCACCTTTCCGTGGGCGAAGGCATCCGCCGCCGATTTCGAGCTGAACAGCCAGTTCCA
GCAGGAGTATTCCCTGCTGCAACAGCGGCTCGATGCCGGACTGGCTGATCGGCTGCTGACGGAGAGCGAC
GCGCAGGCGCGTGCCGAAAGCTATCTCTTCCCGCAGGAGTTCGCTGCGCTGCGTCCGTTGCTGGCCGACG
CGCTCGACACGCTGTTCGCCCGCTCCGATTTTGAAACCCAGTTCGCGCCACGCGGCATCTACTTTGCCAG
CGGCACCCAGGAAGGTCTGCCGTTTGACCGGGTAATGGGCGAGCTGAACCGTGCCCTGAATCTGCCAGGC
CAGCAGGCGGGCGAATCGGGCAGCTGGGATCAGGTCGATAAGGACGCCCCGATTCCGCAGAACAAAGGGC
AGAGTTTCTTCCTCAAAGGCGTGCTGGAAAATGTAGTTTTCCAGGAGTCGGGTCTGGCGGGCAGCAACCG
CTGGTGGGAGCTGCGCAACCGCGCCGGACTCTGGTCAGGCTATCTGGCGCTGCTGTTGCTGTTACTGGTC
GCGGGCGGTCTGTGGCTCACCAGCTACAGCAAGAACAAAGCCTATCTGCAGGAGATGGCCGCTAAAGCGC
CGCAGGTGGAGCAACTAGGCGACCAGCTTCAGAAGCAGGTCAACGGCGATCTCTTTGCGCTGGTGCCTTA
TCTCAACACCCTGTTGCACCTGCCGGAAAGCGCCGACTTCTCGCTGGAATCGCCGCCGCTGACGCGTCGT
ATGGGCCTTTATCGTGGCACCGAGGTCAGCGATGCGACGCGTGCGCTTTACGACAAAGCGCTGAAGCAGC
TGCTGTTGCCGCAGGTGGCGCAGAACATCACCCGCTGGCTGCGCAATGACAACGGCAGCGATGCGGATTA
CAGCTATGAAGCGCTTAAGGCCTATCAGATGCTCTATCAGCCGAAGCACTACGATGGCAAGTTCCTGCAG
GCGTGGCTGATGCTTAACCTGTCGCGCGAGCTGCCGCAGAACGTGACACAGCAGCAGGTAAAACAGCTGG
CGTGGCATCTGCAACAGCTGCTGGAGACGCAGATTCACTCGTCGCCATATGCGAAGGATGACGCGCTGGT
AAAGCGCGAGCAGGCGCTGATTAATCAGATGCCGCTGTCACAGCGCGTCTATGGACGCCTGAAGCGCCTG
CTGCAACGTGATGACAGCCTGCAACCGGTGACGCTGGCGGCGCTGGGCGGTCCCCAGAGCGAGCTGGTGT
TTTCCCGTAAAAGCGGTAAATCGGTTAATGACGGTGTGGCAGGTCTCTATACGCCGGACGGCTACTGGCA
GCATGTGGACAAGCAGATTGGTCCGGTGACGCAGGCGCTTTATCAGGACGATCTCTGGGTGCTGGACGGC
GCTGCACCGCAGCAGAAGAGTGAGCAGACCGATCTCGCGGTGCGCCAGCTCTATGTGCAGGACTACATCC
GTCAGTGGGAGCAGTTCCTGAGCGATATCCAGCTCAACAGCAGTGCCGATCTCTCGCAACGTATTAACAC
CGCGCGCTTGCTGTCGGGCAACCACTCGCCGCTGCGCCAGCTGGTCATCAACCTCAGTAACCTGCTGACG
CTGAACCGCGCGCAGCCCGATGAGAAAACGGCGCAGGCGGCAAAGCCGTCGGATAACAGCGCCACCCGCA
CCCTTGAAGCGCTGTTTACCTCGCCTGAAGCGGCTGCGGCGCGTGGACAGGCGGCAGCGCAGGCGTCACC
GGAGCAGGCGGTTGCCGTGCATTTTGCGCCCGTGCTTGAGCTGGCTCAGCCATTACAGCAGGGCAGCAAG
GTGCTGGCGGTGGATGATTTCCTGCATCAGATTGACGATCTCTATCGCTACCTCACGGCGGTGCAGGATG
CCGCCAACAGCGGGATGCCGCCACCGGCCAGCGATGCAATCAGTCGTTTGCAGGCCAGCGCCGGACGTCT
GCCCGGTTCGCTGCAGAATATGGTCTCCAGCATGGCGGTCGGGGCCAGCAGCGATGCACAGCGCCGCGAC
ATGGATAACGTTCGTAAACGCATCACCATGGAAGTGGGCAGTTTCTGTCGTCAGGCGATCGCCGGACGTT
ATCCGCTGGTGCGTTCCGCGCGCAGTGAGGTGACACCCGACGATCTGGCGCGGATGTTCGCCCCCGGCAG
CGGCATGATGGACAGCTTCTTCCGCGACAACCTGGCCAGCAAAGTCGACACCACCAACGCCTCATGGCGC
TTTACGCCGGGTATCGACGGCAAAACGCTGCCGGGCGGCGAAGCGCTGCTGCGTCCTTTCCAGCAGGCGC
AGTCAATCCGCGATGCGTTCTTTGCTAACGGTGCGACCACGCCAGGCTTCCGCGTCACGCTGCGCACCGT
AAAAATGGACAATGACATTCTTAACCTGACGCTGGATGTGGATGGACAGCAATTGCGTTACAGCCACGGG
CCGCAGGCAGTACAGATGGTCAGCTGGCCCGGTCCGGGCGGCACCAGCCAGGTGCGCATGCAGCTGGGCC
TGACCAACGGCACCACCTCAACGCTGGTCACCAGTGGGCCCTGGGCACTCAATCGCTTCTTCGATCGCGC
CCGTGTTACCGCGGCTGGCGGCCTGACCCGCGAAGCCACGTTCAGCGTGGAGGGGCATCAGGTCACGCTG
TTGTTCACCCCAGGGAGCATTCGTAACCCGTTCCAGCTTCCCGGCTTTAGCTGCCCCTGA
 Primer design